SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000255681 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000255681
Domain Number 1 Region: 47-215
Classification Level Classification E-value
Superfamily Macro domain-like 2.54e-36
Family Macro domain 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000255681
Sequence length 221
Comment MACROD1 (Homo_sapiens) MACRO domain containing 1
Sequence
AFLKGLSDKQREEHYFCRDFVRLKKIPTWKEMAKGVSVKVEEPKYKKDKQLNEKISLFCF
DITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCETGQAKITGGYRLP
AKYVIHTVGPIVHGEPSAGQAAGAWEKDRVWGRAGPGKSWDSLVPSPPPGYPSEAAAEVV
LMALREWLEQHKNKVDRLVICVFLEKDENIYRQRLPHYFPV
Download sequence
Identical sequences HGL_H00000255681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]