SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000255882-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000255882-3
Domain Number 1 Region: 25-113,345-466,514-689,792-806,869-956
Classification Level Classification E-value
Superfamily ARM repeat 0.000000704
Family Clathrin adaptor core protein 0.047
Further Details:      
 
Weak hits

Sequence:  HGL_H00000255882-3
Domain Number - Region: 791-875
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0135
Family ADP-ribosylating toxins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000255882-3
Sequence length 1184
Comment PI4KA (Homo_sapiens) phosphatidylinositol 4-kinase, catalytic, alpha
Sequence
MKQVQKLLCMCPVDFHGIFQLDERRRDAVIALGIFLIESDLQHKDCVVPYLLRLLKGLPK
VYWVEESTAWKVRGALPVAESFSFCLVTLLSDVAYRDPSLRDEILEALLQVLHVLLGMCQ
ALEIQEKEYLCKYSIPCLIGISRAFGRYSNTEESLLSKLFPKVPPHSLRIPEELEGVRRR
SFNDFRSILPSNLLTVCQEGTLKRKTSSVSSISQVSPERVMPPPSSPGGSAFHYFEASCL
PDGTALEPEYYFSTVSSSFSVSPLFNGITYKEFNIPLEMLRELLNLVKKIVEEPVLKSLD
AVIATVMEANPSADLYYTTFSDPLYLTMFKMLRDTLYYMKDLPTSFVKEIHDFVLEQFNT
SQGELQKILHDADRIHNELSPLKLRCQANAACVDLMVWAVKDEQGAENLCIKLSEKLQSK
TSSKVIIAHLPLLICCLQGLGRLCERFPMVVHSVMPSLRDFLVIPSPVLVKLYKYHSQYH
TVAGNDIKISVTNEHSESTLNVMSGKKSQPSMYEQLRDIAIDNICRCLKAGLTVDPVIVE
AFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQKFCQPP
STLDVLIVDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYRHCSLAV
INALANIAANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKLTRRLPPIKE
AKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQ
YNSAMKNDTVTSAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLR
STDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKENEEELER
HAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIH
KDQPYYNIPDVPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNK
HQNWVSGLSQHTGLAMATESILQFAGYNKQNTTLGANQLTERPACVTKDYSNFMASLNLR
NRYAGEVYGMIRFSGASGQMSDLNKMMMQDLTTALDHNNSQHYTQAMFKLTAMLISSKDC
DPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKNGVEVPVGH
Download sequence
Identical sequences G5C028
HGL_H00000255882-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]