SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000256646 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000256646
Domain Number 1 Region: 1800-2046
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 427-554
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000863
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 878-1009
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 574-705
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 762-895
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 1100-1209
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000565
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 1005-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000911
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 8 Region: 737-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 9 Region: 266-441
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 125-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000648
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 240-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000015
Family EGF-type module 0.021
Further Details:      
 
Domain Number 12 Region: 1205-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 45-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000127
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 202-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000025
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 15 Region: 162-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 16 Region: 696-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000643
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 1244-1288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 18 Region: 1044-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.027
Further Details:      
 
Domain Number 19 Region: 1404-1436
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0014
Further Details:      
 
Domain Number 20 Region: 1285-1324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 88-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000317
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 1483-1514
Classification Level Classification E-value
Superfamily Notch domain 0.000000392
Family Notch domain 0.0035
Further Details:      
 
Domain Number 23 Region: 1357-1395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000175
Family EGF-type module 0.01
Further Details:      
 
Domain Number 24 Region: 7-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000454
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000256646
Domain Number - Region: 1446-1477
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000256646
Sequence length 2445
Comment NOTCH2 (Homo_sapiens) notch 2
Sequence
MWAEALQCRDDYEPCVNEGICITFHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCV
ARAMLGRATCRCAPGFTGEDCQHSTSHPCFVTRPCQNGGTCHMLSRDTYECTCQVGFTGK
LCQWTDACLSHPCVNGSTCTTVANQFSCRCLAGFTGQKCETDVNECDVPGQCQNGGTCLD
LPGSYQCQCSQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECSCLPGFEGSTCERN
IDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNG
GYGCVCVNGWSGNDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACI
SNPCHKGALCDTNPLNGHYICTCPQGYKGADCTEDVDECAMTNSNPCEHAGKCVNTDGAF
HCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCEMEINECQS
NPCVNNGQCVDRVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCAT
GFTGLLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDG
RCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCVHGMCVDGISRYSCVCSPGFTGQRCN
IDIDECASNPCRKGATCINDENGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSG
YKCLCDAGWVGTNCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECA
SNPCLNQGTCFDDVSGYTCQCSLPYTGKNCQMVLAPCSPNPCENAAVCKEAPDFESYTCL
CAPGWQGRRCTVDIDECVSKPCLNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPC
QNGGSCVDGMNTFSCMCLPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQPGFD
GVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHEINECNSHPCLNEGTC
VDGLGTYRCTCPLGYTGKSCQTLVNLCSRSPCKNQGTCVQEKAESRCLCPSGWTGAYCDV
PDVSCETAARNKGVLAKHLCRNSGVCINAGNTHHCQCPLGYTGSYCEQQLDECTSNPCQH
GATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGL
LCEENIDDCAGGPHCLNGGQCTDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLD
CIQLTNDYQCVCRSAFTGRHCETFVDVCPQMPCLNGGTCSVASNMPDGFICRCPPGFSGA
KCQSSCGQVKCRKGEQCVHTASGPRCFCPKPQECESGCASSPCQHGASCYPQRQPPYYSC
HCSAPFWGSRCQFYTAPTSTPSATCASQYCADKARDGVCDEACNSHACQWDGGDCSLTME
DPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNSKTCKYDKYCADHFKDDHCDQ
GCNSEECGWDGLDCASDRPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIK
QDSQGVPMVYPYYGEKTATMKKQKMLRRSLPDEQEQEVAGSKVFLEIDNRQCVQDSDQCF
KNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLYLLAVAVVIILFIILLGVIMA
KRKRKHGSLWLPEGFTLRRESSNHKRREPVGQDAVGLKNLSVQVSEANLIGSGTSELWVD
DEGPQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLAPTPPQAEQEVDVLD
VNVRGPDGCTPLMLASLRGGSSDMSDEDEDGEDSSANIITDLVYQGASLQAQTDRTGEMA
LHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDAR
MNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNG
ANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVR
LLDEYNVTPSPPGAVLTSALSPVICGPNRSFLSLKHTPMGKKPRRPNAKSTMPTSLPNLA
KEAKDAKGGRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSPGILQASPNSLLAA
AAPPAPVHAQHALSFSNLHEMQPLAPGASTVLPSVSQLLSHHHIVPPGSSSAGSLSRLHP
LTVPADWVNRVEMNETQYSEMFGMVLTPTEGTHPGMAPQSRPPEGKHITTPREPLPPIVT
FQLIPKGSIAQPAGASQPQSACPPAIAGPLPTMYQIPEMARLPSVAFPTAMMTQQDGQVA
QTILPAYHPFPASVGKYPTPPSQHSYASSSAAERTPSHSGHLQGEHPYLTPSPDSPDQWS
SSSPHSASDWSDVTTSPTPGSAGGGQRGPGTHMSEPPHSNMQVYA
Download sequence
Identical sequences G5AW14
HGL_H00000256646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]