SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000256707 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000256707
Domain Number 1 Region: 19-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.63e-96
Family Ankyrin repeat 0.00000861
Further Details:      
 
Domain Number 2 Region: 1215-1281
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000335
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 
Weak hits

Sequence:  HGL_H00000256707
Domain Number - Region: 429-508,717-816
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0894
Family G proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000256707
Sequence length 1772
Comment KIDINS220 (Homo_sapiens) kinase D-interacting substrate, 220kDa
Sequence
MSVLISQSVINYVEEENIPALKALLEKCKDVDERNECGQTPLMIAAEQGNLEIVKELIKN
GANCNLEDLDNWTALISASKEGHLHIVDELLRCGVNLEHRDMGGWTALMWACYKGRTNVV
ELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVYLLLQNGAKVNCSDKYGTTPLVWAARK
GHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTAL
MIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQ
DNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDKGAK
VSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILT
QIFGARHLSPTETDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLE
DEMKTFAGQQIEPLFQFSWLIVFLTLLLCGAIGLLFTFTLGLSLGVAVSLSCLALLYIFL
VVIYFGGRREGESWNWAWVLSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFT
DYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEESQGKKKWKKTCCLPSF
VIFLFLLGCIIAGITLLAVFRVDPRHLTVNAVLVSIASVVGLALVLNCRTWWQVLDSLLN
SQRKRLHHAASRLHKLKSEGFMKVLKWEVELMARMAKTIDSFTQNQTRLVVIIDGLDACE
QDKVLQMLDTVRVLFSKGPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHL
PVFLNSRGLSNARKFLVTSTTNGDIACSDAPGLQEDVDRRVSQNSLGELTKLGSRTALNR
RDTYRRRQMQRTITRQMSFDLTKLLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQITF
NWDRLASWINLTEQWPYRTSWLILYLEETEGVPDQMTLKAIYERISKNIPTTKDVEPLLE
IDGDIRNFEVFLSSRTPVLVARDVKTFLPCTVNLDPKLREIIADVRAAREQINIGGLAYP
PLPLHEAPPPRAPSGCSQPPSVCSSSTSFNGPFAGGVVSPQPHSSYYSGMTGPQHPFYNR
PFFAPYLYTPRYCPGSSQHLISRPSVKTSLPLREQSSGLAVIKEDAAEGLPSPTDSSRGS
GPATGPVLSLNSMNVDAVCEKLKQIEGLDQSLLPQYCATIRKANINGRVLAQCNIDELKK
EMNMNFGDWHLFRSTILEMRNAENQVVPEDPRFLPENASTVAAHGESARRSSHTELPHTE
LSGQAPYTLNFSFEELNTLGLDEGAPRHSNLSWQSQTRRTPSLSSLNSQDSSIEISKLTD
KVQAEYRDAYREYIAQMSQLEGGPGSAAVSGRSSPHSTYYLGPSSSGGSIHSGLELEKGK
EGEPKPDEARKPFLAKRTDVLDYSSSGVSTSDASPLDPITEEDEKSDQSGSKLLPGRKGA
ERPSLFQTELKLKGGGLRYQKLPSDEDESGPEESDHTPLLRDDKDRKAEGKAPEHGPEPL
RTFAKAKEYLSDALLDKKDSSDSGVRSSESSPNHSLHNEASDGAQLEKANLIELEDEGHG
ARRGLPHSLSGLPDPVLARMSICSEDKQSPSECSLIASSPEEGWPACSRAYNLNRTPSTV
TLNNNSAPANRPGQGLDDVEGVRETSQVLLRPSSGPGPGPSPTTLQNENLKSLPHKRGPR
TSYIRLPKEPSELHSGAPSDSTGFGEERESIL
Download sequence
Identical sequences G5C0Y3
HGL_H00000256707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]