SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000256832 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000256832
Domain Number 1 Region: 618-985
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.02e-129
Family Hect, E3 ligase catalytic domain 0.00000000368
Further Details:      
 
Domain Number 2 Region: 69-198
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.85e-26
Family Synaptotagmin-like (S variant) 0.01
Further Details:      
 
Domain Number 3 Region: 222-264
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000473
Family WW domain 0.001
Further Details:      
 
Domain Number 4 Region: 561-600
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000707
Family WW domain 0.00024
Further Details:      
 
Domain Number 5 Region: 397-436
Classification Level Classification E-value
Superfamily WW domain 0.000000000000132
Family WW domain 0.0016
Further Details:      
 
Domain Number 6 Region: 515-549
Classification Level Classification E-value
Superfamily WW domain 0.000000000000415
Family WW domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000256832
Sequence length 992
Comment NEDD4L (Homo_sapiens) neural precursor cell expressed, developmentally down-regulated 4-like
Sequence
PGLVAGQALPGQQLLQSPPLEAPPSACSWLLITCPGTGKTRISLPLLLLLGETDRLPASR
PACLSGSPLPEVFLLGICDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVN
PSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVK
GFLRLKMAYMPKNGGQDEESSEQRDDMEHGWEVVDSSDSASQHQEELPPPPLPPGWEEKV
DNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEA
SEGGEGPEPWETISEEVNMTGDSLGLALPPPPASPVSRTSPQELSEELSRRLQITPDSNG
EQFTSLIQREPSSRLRSCSVTDTVAEQGHLPPPSVAYVHTTPGLPSGWEERKDAKGRTYY
VNHNNRTTTWTRPIMQLAEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKD
SPIRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTT
TWEDPRLKFPVHMRSKASLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQN
PAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDV
LKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCN
EDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWI
LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQ
MNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWF
WKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCF
NRLDLPPYETFEDLREKLLMAVENAQGFEGVD
Download sequence
Identical sequences G5AYX9
HGL_H00000256832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]