SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000257287 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000257287
Domain Number 1 Region: 627-847
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000107
Family Tropomyosin 0.0088
Further Details:      
 
Weak hits

Sequence:  HGL_H00000257287
Domain Number - Region: 196-378
Classification Level Classification E-value
Superfamily Tropomyosin 0.0108
Family Tropomyosin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000257287
Sequence length 1214
Comment CEP135 (Homo_sapiens) centrosomal protein 135kDa
Sequence
MTTAAERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSSVKAEKE
SANSDFVLEPYKLENARLSKENNELYLELMKLRECSEQNIKELKTTLKKCTRETADLKFL
NNQYVHKLKLLEKESKAKNEKIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPAPPS
EVNSYPVPQPEDPYIADLLQIADNRIQELQEEVHQLQEKLAVMESGVRDYSKQIELRERE
IERLSVALDGGRSPDVLSLETRNKTNEKLIAHLNVQVDFLQQANKDLEKHLQELMETKET
VATEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKEIKRNLCEMRN
LEETMTKLQLELDLCHKEKERLSDELLLKSDLETVVHQLEQENQRLSKKIESFAVTEREL
TLEVERMRLEHGIKRRDKLPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSINYCAH
EKIPVFKTPEKGDYNSEIHLVTRERDELQRMLERFEKYMEDIQCNVKLLTAERDKLSVLY
NEAQEELCALRQESAHTTIPSSLVNLREKEKELALSDLRRIMAEKEDLREKLKNIQEMSA
MGKSELEKTIEHLTCVNHQLESEKYELQSKVLIMKETIESLENKSKLQAQKLSHVAGDSS
HQKTEMNSLRVVNDQLQRSLDDYQHQLSIKRGELESAQEQIKILEEKIGELNLKMTSQNE
EAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQEILASKEKAVAQMKITVSEYELSMNQ
LKETLSNRDREISSLRRQLDTTLKELDEVGKSREISFKENRRLQDDLATMARENQEISLE
LEAAVQEKEEMKSRVHNYITEVSRWESLMAAKEQENQDLLDRFQMLHNCAEDWEIKAHQA
EGESSSVRLELLSIDTERRHLRERADLLEKEIQEHINAHHAYESQISSMAKAMARLEEEL
RHQEDEKATVLNDLSSLRELCIKLDSGKDVMTQQLNSKNLELERALVELENVKSESELLK
KQLSSERCTIKNLESLLATNRDKEFHSHLTSHEKDTEIQLLKEKLTLSESKLTSQSRENT
MLRAKVGQLHTDYDALKRQISTERYERERAIQEMRRHGLPTSPLSSTLKSPSHSPEHKEM
EWPVSVCNCGSTEDEKLLRDETIQSQRRAEGLSQLRAPSVRETPRNITKAESSLAIYSIS
VRKKSSLGKKLSQG
Download sequence
Identical sequences HGL_H00000257287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]