SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000257552 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000257552
Domain Number 1 Region: 63-172
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-28
Family Canonical RBD 0.0000141
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.89e-18
Family Canonical RBD 0.000048
Further Details:      
 
Weak hits

Sequence:  HGL_H00000257552
Domain Number - Region: 195-248
Classification Level Classification E-value
Superfamily ApbE-like 0.0523
Family DVU1097-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000257552
Sequence length 329
Comment MSI1 (Homo_sapiens) musashi homolog 1 (Drosophila)
Sequence
EGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPK
VAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFG
FVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVVPYGMDAFMLG
IGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPM
AAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYI
SAASPAPSTGFGHSLGGPLIATAFTNGYH
Download sequence
Identical sequences A0A091CZV4 G5B778
HGL_H00000257552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]