SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000258098 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000258098
Domain Number 1 Region: 21-185
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-23
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 
Domain Number 2 Region: 614-644
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.000000000157
Family Eferin C-derminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000258098
Sequence length 645
Comment RAB11FIP5 (Homo_sapiens) RAB11 family interacting protein 5 (class I)
Sequence
MALVRDAEPASGPSRWLPTHVQVTVLRARGLRGKSSGVGSTSDAYTVIQVGREKYSTSVV
EKTQGCPEWREECSFELPPGALDGLLRAQEADAGPAPWASGSAAACQLVLTTMHRSLIGV
DKFLGQATVALDEVFGAGRAQHTQWYKLHSKAGKKEKERGEIQVTIQFTRNNLSASMFDL
SIKDKPQSPFSKLKDKMKGKKKYDLESASAILPSSALEDPELGSLGKMGKAKGFFLRNKL
RKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPSRSSWLSSEGGRDSIQSPKLL
THKRTYSDEASQLRAAPTRALLDLQGHLDAGPRTAPQLHFWPISTLQLPSQPPARHRSSI
SGPFPPSSSLHSVSSRPSEEGSRSSDDSWGRGSRGAGSSSEVVPGPEELSTQAKAQAREE
RAQTPEGKPVQVATPILVSSEAVVEKEGARKEERKPRMGLFHHHHQGLSWSELGRRGSIG
EKGGPTVGASPQHLSSGEDKAKSSWFGLRESKESSQKPSPHPVKPLSATPVEGSPDRKQP
RSSLSTALSSGLEKLKTVTSGSIQPVAPAPQLGQTVDTKKLKDSAVPDQSAKYYHLTHDE
LIGLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPP
Download sequence
Identical sequences G5CBQ6
HGL_H00000258098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]