SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000258341 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000258341
Domain Number 1 Region: 792-846
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000865
Family Laminin-type module 0.0000555
Further Details:      
 
Domain Number 2 Region: 688-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000198
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 250-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 848-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000257
Family Laminin-type module 0.00019
Further Details:      
 
Domain Number 5 Region: 899-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 6 Region: 411-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 362-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 8 Region: 306-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 737-794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.00029
Further Details:      
 
Domain Number 10 Region: 947-992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000204
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 11 Region: 1045-1248
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000296
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0089
Further Details:      
 
Weak hits

Sequence:  HGL_H00000258341
Domain Number - Region: 1241-1491
Classification Level Classification E-value
Superfamily Tropomyosin 0.000347
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number - Region: 64-142
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0255
Family Galactose-binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000258341
Sequence length 1573
Comment LAMC1 (Homo_sapiens) laminin, gamma 1 (formerly LAMB2)
Sequence
MDECTDERGRPQRCMPEFVNAAFNVTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQ
PHLQHGAAFLTDYNHQADITWWQSQTMLSGVQYPNSINLTLHLGKAFDITYVRLKFHTSR
PESFAIYRRMREDGPWIPYQYYSGSCENTYSKASRSFIRTGENEQQALCTDEFSDISPLT
GGNVAFSTLEGRPSAYNFDHSPVLQEWVTATDVRVTLNRLNTFGDEVFNDPKVLKSYYYA
ISDFAVGGRCKCNGHASECVKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESA
SECLPCDCNGRSEECYFDPELYRSTGHGGHCTNCRDNTDGANCERCLENFFRFGNSEACS
PCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCHPGFHSLTEAGCRPCSCNPSGSTDEC
NVETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYDIS
SAFQIGEDGWHVEQRDGSEASLEWSSERQDISVISDSYFPRYFIAPAKFLGNQVLSYGQN
LSFSFRVDRRDTRLSAEDLLLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWR
PTLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASARPGPGVPATWVESCTCPVGY
GGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDPETGVCNCRDNTAGPHCEKCSD
GYYGDPTVGTSSDCQPCPCPGGSSCALVPKTKEVVCTTCPVGTTGKRCELCDDGYFGDPQ
GNSGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPN
PADKCKACSCNPYGTVKQQRSCNPVTGQCECLPHVAGRDCGACDPGFYNLQSGQGCERCD
CHALGSTNGQCDIRSGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCK
DDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVADHRVKLQELESLI
ANLGTGVEMVTDQAFEDRLKEAEREVMDLLREAQDVRDVDQNLMDRLQRVNNTLYSQVSR
LQNIRNTIEETGSLAEQARARVESTEHLIEIASRELEKAKVAVANVSITQPESTGDPNNM
TVLAEEARKLAERHKQEADDIVRVAKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKY
EQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVAQLAPVDSETLENEANKIKKEAADL
DRLIDQKLKDYEDLREDMIGKELEVKKLLESGKVEQQTADQLLARADAAKALAEEAAKKG
RNTLQEANDILNNLKDFDRRVNDNKTAAEEALRRIPSIEQTIAEADEKTRDARLALGSAA
ADATEAKSKAYEAERIASAVQKNATSTKAEAEQTFAEVTDLDKEVNSMLRQLQEAERELK
RKQDDANQDMMMAGMASQAAQEAEINARKAKNSVNSLLSMINDLLEQLGQLDTVDLNKLN
EIEGTLSKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRDIEEIMKDIQNLEDIKKTL
PSGCFNTPSIEKP
Download sequence
Identical sequences G5B451
HGL_H00000258341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]