SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000258526 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000258526
Domain Number 1 Region: 785-913,1087-1236
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.39e-28
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 14-188
Classification Level Classification E-value
Superfamily Sema domain 4.05e-26
Family Sema domain 0.01
Further Details:      
 
Domain Number 3 Region: 190-236
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000196
Family Plexin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000258526
Domain Number - Region: 403-489
Classification Level Classification E-value
Superfamily E set domains 0.00106
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 
Domain Number - Region: 492-556
Classification Level Classification E-value
Superfamily E set domains 0.0306
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000258526
Sequence length 1303
Comment PLXNC1 (Homo_sapiens) plexin C1
Sequence
MVRIAQSADALFQGQAALDCSHGHPDGRPLLLSSSLVEALDIWAGVFSAPTGEGQERRTR
ATTALCLFRMSEIQARAKSCSWDFETQQNCKEGDQPERVQPIASSTLIHSDLTSVYGTVV
LNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIKEETPVFYKLVPDPRKKSYIYLTAG
KEVRRIRVANCSKHKSCSECLTAADPHCGWCHLLQRCTFKEDCVESKHFENWLDISSGAK
ECPKIQITRSSRDKTTVTVVGPFSSRRSECVVKNMDTSKVLCQERSQENQACTCILLTRP
SYRDVLLVNVTFSFGFLNLSERFNFTNCSSLRECSACTGTGCAWCKRERKCIHPFTFCDP
SEYERNQELCHVALEKPPKTPGGGRFKETSSNRTHPGPQVFHIKAIEPQKISTLGKSNVI
VTGANFTRASNITMILKGTSTCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGN
CSSVGALSYIALPHCSLIFPATTWISGGQNITIMGRNFDVIDSLIISQELKENINVSEYC
GSNFCRFLAPNLKSSKVRPNVVVKLRVQDTYLDCGTLQYLEDPRFTGYRVESEVDTELEV
KIQKENDNFNISMKDIEITLFXPLNCSFENITRNQDLTTILCKIKGIKDANSIATSSKKV
RVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRQKSKELSRKQSQQLELLE
SELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRD
ANEKNESLTALDALICNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSI
LEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLN
QKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVL
DCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQVGTRQKELVDIDSSSVILEDGITK
LNTIGHYEISNGSTIKVFKKIANFTSDVEYTDDHCHLILPDSEAFQDVQGKRHRGKHKFK
VKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDV
VHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAP
TNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSLEMEEFLTQESKKHENEFNEEVALTEIY
KYIVKYFDEILNKLERERGLEEAQKQLLHVKVLFDEKKKCKWI
Download sequence
Identical sequences G5C0U3
HGL_H00000258526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]