SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000258729 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000258729
Domain Number 1 Region: 193-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.42e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 313-397
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.54e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 110-187
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 14-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000766
Family Canonical RBD 0.01
Further Details:      
 
Domain Number 5 Region: 406-472
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000112
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000258729
Sequence length 546
Comment IGF2BP3 (Homo_sapiens) insulin-like growth factor 2 mRNA binding protein 3
Sequence
MQSEPECQNLPRVLDSLLVQYGVVETCEQVNTESETAVVNVTYSSKDQARQALDKLNGFQ
LENFTLKVAYIPDEVAAQQTPSQQPRGRRGLGQRGSSRQGSPGSVSRQKPCDLPLRLLVP
TQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEI
MHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNP
ERTITVKGSVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMP
PPTSGPPSAMTPPYPQFEQSETETVHLFIPAPSVGAIIGKQGQHIKQLSRFAGASIKIAP
AEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVI
GKGGKTASTSAKPVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQASCSEKNSG
NSDSGKAAPTAEGSAKWTTSVKAEVKAQEKPPTEADAKPKTDCLTNRWTLTLSRITCTSC
YLASCF
Download sequence
Identical sequences G5BHC3
HGL_H00000258729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]