SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000260323 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000260323
Domain Number 1 Region: 145-285
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.03e-32
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 
Domain Number 2 Region: 966-1096
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.66e-22
Family Synaptotagmin-like (S variant) 0.013
Further Details:      
 
Domain Number 3 Region: 19-73
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000260323
Sequence length 1137
Comment UNC13C (Homo_sapiens) unc-13 homolog C (C. elegans)
Sequence
KMHVFRKTLQALVYPMSCTTPHAFEVWTATTPTYCYECEGLLWGIARQGVRCLECGVKCH
EKCQDLLNADCLQRAAEKSSKHGTEDKTQTIITAMKERMKIREKNKPEVFEVIQEMFQIP
KEDFVQYRKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKKRT
KTIFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEV
RTLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTE
VKSSGSVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPG
VPAIMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSK
YRENFPASSSERLQDLKSTVDLLTSITFFRMKVLELPSPPRASMVVKDCVRACLDSTYKY
IFDNCHELYSQLTDPSKQQDIPQEDQGPTSRNLDFWPQLITLMVTIIDEDKAAYTPALNQ
FPQELNMGKISAEIMWTLFALDMKYALEEHQKQRLCKSTDYMNLHFKVKWFYNEYVHELP
AFKDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDV
FAQLNQSFEIIRKLECPNPEALSHLMRRFAKTISKVLVQYAAIVSSDFSSYCDKENVPCV
LMNNIQQLRVQLEKMFESMGGKLDPEASTILKELQVRLSGVLDRLSVIYGESFQLVIEEC
VKQMSFELHQMRANGSTASSRSSATLDAGIVLRPLMELLDKTLSLSAKICEKTVLKRVLK
ELWKLVLNKIEKQIVLPPLTDQTGPPMIFIAAKDLGQLSKLKEHLSREDARGLTPRQCAV
LEEVLATVKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSR
SSKDAVGQISVHVDIAATPGTGEHKVTVKVIAINDLHWQTTAMFRPFVEVCMLGPNLGDK
KRKQGTKTKSNTWSPKYNETFQFTLSKESQPAAYELHLAVKDYCFAREDRVIGMTVIQLQ
TIEEKGSHGAWYPLLRSVSMDETGLTILRILSQRTGDDVAKEFVRLKSETRVTEESA
Download sequence
Identical sequences G5B2P5
HGL_H00000260323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]