SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000260526 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000260526
Domain Number 1 Region: 672-767,792-878
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 202-470
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.29e-26
Family FCH domain 0.055
Further Details:      
 
Domain Number 3 Region: 596-652
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000688
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000260526
Sequence length 1249
Comment ARHGAP29 (Homo_sapiens) Rho GTPase activating protein 29
Sequence
MIANKQKKTKKKRVGASGQLSTDVTTSEMGLESVRPNSIFDPDYIKELVNDIRKFTQMLI
FLKEAVLSDCFKEIVPIRLEKLLHVLKSVMNKHQNLNSVDLQNAAEVLTAKVKAVDFTEI
NEENKNDLFREVSSSTENLAFTFGNTLTNLFMGDLSNDSSFRLPVSQDKSFENISVDSVD
SSNEKGNFSPIELDNLLLKNADSVKLALSYAKTWSEYTKNIVSWIEKKLNLELESTRNNV
KLAEATRANIGLQEFMPLQSLFTSALLNDIESSQLIQQTIAALQANKFVQPLLGRKNEME
KQRKEIKELWKQEQNKMLETETALKKAKLLCMQRQDEYEKAKSSMFRAEEEHMCSSSGLV
KNLNKQLEKKRRLEEEALQKVEEDDELYKVCVTNVEERRNDLENTKREILTLRTLVFQCD
LTLKAVTVNVFQMQHLQVASLANSLQSLCDNAKLYDPGQAYSEFVKATNSTEEKVDGNVN
KQLTSAYRPDSLEDVVCLSDSCNKIEEDRCSNSADTSGPSFIRSWTFGVVSDSESTGGSS
ESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREPPSPSEAGPSSLGIFKKTLMSK
AAVTHKFRKLRSPTKCRDCEGIVVFQGVECEECFLVCHKKCLENLMIICGHQKLPGKMHI
FGAEFIQVAKKEADGIPFILKICVSEIENRALSLQGIYRVCGSKLKIEKLCQALENGMHL
VDMSEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLTKEIQHVNEEQEIKKDSTEDKK
YANTCIEINRILLKSKDLLRQLPASNFNSLRYLILHLKRVVDHAEENKMNAKNLGVIFGP
SLIRPRPTTAPVTISSLAEYSNQAQLIEFLITYSQKILQLQDVTCSAGVVAPLVDQCSLL
KPLLSPEERDSEHCMKSLFFSSKEDIHSESNTFQPTRSPEESEHKQNALGKCDACLIDPE
LESASQKMEDVCKTSKLLTVKSDRVTNSVWRHTPRTKIRPVSLPLDRLLQTSPPTERNGK
NMRNVNSNKFCKNPTVEEFNIKDIPSTICSKFNGVDQQNLQKTWAKQCEPNNLTAKSTII
VPSTLQEKGVPVRISGDDSSSATQLSKPYTEPLRSARETSERRSSDSYPLAPVRGPRTLQ
PQHWTTFYKPHTTFYKPHTPTSSIRGSEEKQVSPTAAVPPGSAHTAQGQVTKSLPDSADT
SACPAQLNSEPKGNSEEHDFPDLTPVCQRPKLKRMQQFEDLEDEIPQFV
Download sequence
Identical sequences G5AW27
HGL_H00000260526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]