SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000260956-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000260956-4
Domain Number 1 Region: 11-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.27e-27
Family La domain 0.00000767
Further Details:      
 
Domain Number 2 Region: 204-301
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000136
Family Canonical RBD 0.00000302
Further Details:      
 
Domain Number 3 Region: 102-173
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000489
Family Canonical RBD 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000260956-4
Sequence length 373
Comment SSB (Homo_sapiens) Sjogren syndrome antigen B (autoantigen La)
Sequence
MAENGDNEKLAVLEAKICHQIEYYFGDFNLPWDKFLKEQIKLDEGWVPLEIMIKFNRLNC
LTTDFNVIVEALSKSKAELMEISEDKTKTRRSPNQPLPEVTDEYKNDVKNRSVYIKGFPT
DATLDDIKAWLEDKGQVLNIQMRRTLHKAFKGSICAVFDSIESAEKFVETPGQRAKQEQE
EKQKLAEDAEMKSLEEKIGCLMKFSGDLDDQTCREDLHVLFSNHGEIKWIDFVRGAKKGV
ILFIEKAKEALDKAKDANNGTLQLRNKEVMWEVLEGEVEKEALKKIIEDQQESLNKWKSK
GRRFKGKGKGNKAAQPGSAKGKVQFQGKKTKFGSDEGCDENGGAGTVKRAREETDKEEPT
SKQQKTENGAGDQ
Download sequence
Identical sequences G5B250
HGL_H00000260956-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]