SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000260983 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000260983
Domain Number 1 Region: 983-1025
Classification Level Classification E-value
Superfamily WW domain 0.0000000000178
Family WW domain 0.0013
Further Details:      
 
Domain Number 2 Region: 190-292
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000012
Family Synaptotagmin-like (S variant) 0.049
Further Details:      
 
Domain Number 3 Region: 817-847
Classification Level Classification E-value
Superfamily WW domain 0.00000000371
Family WW domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1208-1261
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.0000112
Family Hect, E3 ligase catalytic domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000260983
Sequence length 1261
Comment HECW2 (Homo_sapiens) HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
Sequence
MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQGSLPENMTLQRANSDTDLVTSESRSS
LTASMYEYMLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQ
IVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPAVMMGAEGMEDGVSGNLH
SRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFPTCAHHGQERRSTIISNTT
NPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKLTIPVQRLLERQAIGDQMLS
YSLGRRLPADHVSGYLQFKVEVTSSMHEDASPEAVGTILGVSTVNGDLGSPSDDEDVPGS
HQDSPGCANGPVSEDSAADGTPKHSLRTSCTLEIEAEELAATSSRASPPRGRQDSLNDYL
DALEHGGPSRPGPMGASPKLRSSFPTDTRLSAMLHIDSDEEDHEFPQDRGCPSSLEEDGG
LIMFGRAASPVSYSGLEAARPLDTGERPEAARHGDGHGDGDEALPGPVDGSPDPAPEEGE
AAGPESGPVAEPEPEPEPRGSEEAEQPASGADPGTPNTSAGSRRAASEAESLDQGSEPSQ
VSSETEPSDPARTESASEASARLEGESDPEGADSSCTESAASQLSSAHTLCSSPGSARFP
GTPAFSSHTQATHDWAQLTGLDSEQRSEESSGEQCRRGVTDARRPTSGSAAPYSLLSAHP
PLSEAAGRARGPLWSEAWGVRSRAPASPGRKCCGVRFGEDPAGPSGCCTVSESLAGSSSS
SFARGSPFVCSFGKLRAVTHSPISVSALIPLAPRCDSDWEARIDSHGRIFYVDHVNRTTT
WQRPTAPPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTSAVDGAGEEADFHQA
SADFRRESVLPHSTSRSRLTLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMI
TKVRRDTHHFERYQHNRDLVGFLNMFANKQLDLPRGWEMKHDHQGKAFFVDHNSRTTTFI
DPRLPLQSSRPTSALAHRQHLTRQRSHSAGEVGEDSRHAGPPVLPRPSSTFSTVSRPQYQ
DMVPVAYNDKIVAFLRQPNIFEILQERQPDLTRNHSLREKIQFIRTEGTPGLVRLSSDAD
LVMLLSLFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFE
AKLRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEE
G
Download sequence
Identical sequences G5AX16
HGL_H00000260983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]