SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000261381 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000261381
Domain Number - Region: 460-536
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0921
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000261381
Sequence length 891
Comment XYLT1 (Homo_sapiens) xylosyltransferase I
Sequence
MHLGGPLSDISARRLQARKSPRQSDPGCACRIHWEALNTDLVLLGSKLQMCLDTEPPVSP
TFPNLTELGEAHRASRQCVCYQCGFDQDYIHHCPHFSLACIEPYGPESILAVHISELQDG
YFSHRPKEKVRTDSNNENSVPKGFENVDNSNFAPRTQKQMHQPEAAKKPPSGQKHRLQRK
LEPQDKGQGHAPPKCDIAGKEATSALSRSKSQHCRQEIGETYCRHKLGLLMPEKVTRSCP
LEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDK
RSNYLHRQVLQFARLYSNVRITPWRMATIWGGASLLSTYLQSMRDLLEMPDWPWDFFINL
SAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRR
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAESFFHTVLENSPHCDTMVDN
NLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEI
IGQLDYYLYGNYPAGTPGLRSYWENVYEELDGVHSLSDVALTLYHSFSRLGLRRAESSLH
TEGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIA
SPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPV
NVIAATYDILIESTAEFTHYKPPLNSPLRPGVWTVKILHHWVPVAETKFLIAPLTFSNRQ
SIKAEEALRLHNGPLRSAYMEQSFQSLNPVLSLPIVPAQVEQARRNAASTGPALESWLDS
LVGRMWTAMDVCATGPTACPVMQACSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences G5AK16
HGL_H00000261381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]