SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000261537 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000261537
Domain Number 1 Region: 434-486,513-716
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-53
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 145-220
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.88e-23
Family Mib/herc2 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 63-137
Classification Level Classification E-value
Superfamily RING/U-box 2.71e-21
Family ZZ domain 0.0053
Further Details:      
 
Domain Number 4 Region: 11-73
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 6.15e-20
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 5 Region: 880-940
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000412
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  HGL_H00000261537
Domain Number - Region: 751-795
Classification Level Classification E-value
Superfamily RING/U-box 0.00207
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number - Region: 798-843
Classification Level Classification E-value
Superfamily RING/U-box 0.0162
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000261537
Sequence length 942
Comment MIB1 (Homo_sapiens) mindbomb homolog 1 (Drosophila)
Sequence
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
RCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHL
RHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGN
RNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPS
GNRWTFNPAVLTKANIVRSGDSAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDIL
KLLLKQNVDVEAEREGGRRAXXXKSAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVN
KGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNA
LHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNKGNANLDIQNVNQQTAL
HLAVERQHTQIVRLIMGLGTQGAEKKSAASIACFLAANGADLGIRNKKGQSPLDLCPDPS
LCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCS
PRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVV
ERRVPFVLCCGGKSAEDASDELSSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCP
VCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Download sequence
Identical sequences HGL_H00000261537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]