SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000261655 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000261655
Domain Number 1 Region: 919-998
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-21
Family SH3-domain 0.00029
Further Details:      
 
Domain Number 2 Region: 149-227
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-20
Family SH3-domain 0.00000513
Further Details:      
 
Domain Number 3 Region: 473-585
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000195
Family Fibronectin type III 0.00000213
Further Details:      
 
Domain Number 4 Region: 293-451
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000002
Family Fibronectin type III 0.0061
Further Details:      
 
Weak hits

Sequence:  HGL_H00000261655
Domain Number - Region: 860-895
Classification Level Classification E-value
Superfamily SH3-domain 0.00166
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000261655
Sequence length 1025
Comment RIMBP2 (Homo_sapiens) RIMS binding protein 2
Sequence
MREAAERRQQLELEHEQALAILNAKQQEIELLQKCRVRELEEKCWAQSEQFHLLSRDLEK
SRQHAGKTDLLSGGAAAPGKAFPPFMNGLATSLGKGHKGSAGRYSVISDHIPLPGDQPEP
LSAEPGFLSRSSSPRCRFESDMDNERNSNTSKQRYSGKVHLCVARYSYNPFDGPNENPEA
ELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDSESRLAGTLGTEQDQN
LLNHSGVGVGLGLEGESILDLHSPTHADPGITDIGRGPLDTNIDDVGGDIVPYPRRLALI
KQLAKSVIVGWEPPALPPGWGTVSGYTVVDTTEPRLSLPLGARTKALVEKLDTATCTYRI
SVQCVTSRGSSDALQCTLLVGKDVVVAPSHLRVDSITQISAQLSWLPTNSNYSHVIFLNE
EEFDVVKAARYTYQFLNLRPNMAYKVRVLARPHQMPWQLPLEQREKKEASVEFSTLPAGP
PAPPQDVTLQAGVTAATVQVSWKPPALTATGLSNGAHVTGYGVYAKGQRVAEVIFPMADS
TAVELGRLRGLEARAVTVRTLSAQGESADSAPTPIPPDLLVPPAPMPRAAPPPKPLASVP
DTKEEHPGVHAKVEAWEQGRTPGSAHGNLLELPGLQGAGPGRRSPSPSRILPQPQGAPVS
TSVAKAMAREAAQRVAESSRLEKRSLFLERNSVGLYANSDEEDGYASPELKRRGPSVDDF
LKGSELGRQPHCCHGDEYHTESSRGSDLSDILEEDEEELYSEMQLEDGGRRRPSSSSHGA
LKILGSPASAGRAERVEQGGRRFPLGGASPQRPRLAIGEKRRGRAGPSSPRSVAGDRGRG
AHPRPLGKSGDGARPPQVYGDKDPDGFYRGETCARLGLIPCNMVSEVQADDEEVRGQLLR
QGFLPLSTPVEEIERSRRSGRPRSVSTRRVVALYDYDPRESSPNVDVEAELTFCTGDIIT
VFGDIDEDGFYYGELNGQRGLVPSNFLEEVPDDVEVHLSEAPPLCSRDTALRAKAKRKKS
VHFTP
Download sequence
Identical sequences G5AWP5
HGL_H00000261655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]