SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000261917 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000261917
Domain Number 1 Region: 383-573
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.28e-53
Family cAMP-binding domain 0.00000000951
Further Details:      
 
Domain Number 2 Region: 118-386
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-38
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000261917
Sequence length 989
Comment HCN4 (Homo_sapiens) hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Sequence
XTSPGEDRTPPGLAAEPERPGAAAQPAASPPPTQHPASASLEQPAADTAIKVEGGAAASD
QILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPY
SDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGI
VVEDNTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVETRIDSEVYKTARALRIVR
FTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFL
VPMLQDFPSDCWVSLNDMVNNSWGKQYSYALFKAMSHMLCIGYGKQAPVGMSDVWLTMLS
MIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHR
YQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQP
GDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTY
CRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFNYQE
NEIIQQIVQHDREMAHCAHRVQAAGSATPTPTPVIWTPLIQAPLQAAAATTQQLAGFSAP
AGLSPLLPSSSSSPPPRACGSPPASTLSCAAAATTTAGFGHFHKALGGSLSSSDSPLLTP
LQPGARSPQAAQLPPLLPGARGGLGLLEHFLPPPPSSRSPLSSPGQLGQPPGELSPGLAA
GPPSTPETPLRQPERPSFVAGPSGGASLVAFTPRGGFSPPSHSPGPPRTFPSAPPRASGS
HGSLLLPPVSSPPPAQVPQRQGTPPLTPGRLTQDLRLISASQPALPQDGAQTLRRASPHS
SGESVAAFPLFPRAGAGSGGLGPPGRPPGATPGQHVTLPRKTSSGSLPPPLSLFGARATS
SGGPPLTAATQREPGARSEPVRSKLPSNL
Download sequence
Identical sequences HGL_H00000261917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]