SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262031 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262031
Domain Number 1 Region: 30-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.72e-22
Family Canonical RBD 0.0000502
Further Details:      
 
Domain Number 2 Region: 125-246
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-20
Family Canonical RBD 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262031
Sequence length 407
Comment RBMS2 (Homo_sapiens) RNA binding motif, single stranded interacting protein 2
Sequence
MLLSVTSRPGISTFGYNKNNKKPYVSLAQQMAPPSPSSSTPNSSSGGNGNDQLSKTNLYI
RGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKAS
GVQAQMAKQQEQDPTNLYISNLPLSMDEQELEGMLKPFGQVISTRILRDTNGTSRGVGFA
RMESTEKCEAIITHFNGKFIKTPPGVPAPSDPLLCKFADGGPKKRQNQGKFVQNGRAWPR
SGDMGGMALTYDPASALQNGFYPAPYNITPNRMLAQSALSPYLPSPVSSYQRVTQASPLQ
VPNPSWMHHQSYLMPPSGSVLTPGMDHPISLQPASVMGPLTQQLGHLSLSSTGTYVPTAA
AMQGAYISQYTPVPSSSVSVEENSGQQNQVAVETPSDHGVYSFQFSK
Download sequence
Identical sequences G5BB69
HGL_H00000262031 XP_004861340.2.39548 XP_004861341.1.39548 XP_004861342.1.39548 XP_012933723.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]