SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262186 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262186
Domain Number 1 Region: 462-635,664-725
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.32e-45
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 729-936
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-37
Family cAMP-binding domain 0.00071
Further Details:      
 
Domain Number 3 Region: 20-109
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.74e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262186
Sequence length 1208
Comment KCNH2 (Homo_sapiens) potassium voltage-gated channel, subfamily H (eag-related), member 2
Sequence
MGSAGVRGRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRA
AAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMA
GSPARDTNHRAPPPSWLAPGRAKTFRLKLPALLALTARESSSVRPGGTGGAPGAVVVDVD
LTPAVPSSESLALDEVSALDNHVVGLAEERRALVAPGSLPTGVPGPAHTSPRAHSLNPDA
SGSSCSLARTRSRESCASVRRASSADDIEAMRAGALSPPPRHASTGAMHPLRSGLLNSTS
DSDLVRYRTISKIPQITLNFVDLKGEPFLASPTSDREIIAPKIKDRTHNVTEKVTQRWPR
LPFGQLWGCSLGWECCWGASEVLARPSGLRAGKLGAAKPSMAAPAGKASGTGALRPRTQK
GRMRRAVRISSLVAQEVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGPQAPDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPDVNARIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNXXXXXXXXXXXXXXXXXXXXXXRSLLQHCKPFRGATKGCLRALAMKF
KTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKS
NGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELE
GGFNRQRKRKLSFRRRTDKDPEQPGEVAALGPGGAGGGPSGWGPPGTTWGDSPSSGPSSP
ESSEDEGPGLSSSPLRLVPFSSPRPPGEPRGGXRGRQYQELPRCPAPTPSLLNIPLSSPG
RRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTAT
SPLLPISPAPTLTLDSISQVSQCVAFEELPPGAPELPQDGPTRRLSLPGQLGALTSQPLH
RHGSDPGS
Download sequence
Identical sequences G5AMS5
HGL_H00000262186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]