SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262209 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262209
Domain Number 1 Region: 38-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-43
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 255-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.74e-42
Family Ankyrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262209
Sequence length 943
Comment TRPA1 (Homo_sapiens) transient receptor potential cation channel, subfamily A, member 1
Sequence
MDSMKRSLRKMLRTGEKEPQAVVYHGVDSMSDSKDFKVVFEGNKCRLQHFVKNRWKLNKY
KEANVSPLHHAAAEGQLELMKMIISGSSCEVLNVMDSYGNTPLHWAAENNQVESVKFLLT
QGANPNLRNSSMMAPLHLAVQGMYNEITKVLIEHSSTNINLEGENGNTAVMITCAKDNSE
SLEILGADINITDSEGRSPLVLATASASWNIVNLLLSKGAKVDIKDHLGRNFLHFTVQQP
YGLKSLRPEFMQMQEIKALVMDEDNDGCTPLHYACKQGVPVSVNNLLGFNVSIHSKSKDK
KSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA
LFLSDHNGWTALHHASMGGYTQTIKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAL
LLNYDADIVLNKQRASFLHIALHNKRKEVVLTTIRNKRWDECLKVFTHCSPSNRCPIMEM
IEYLPECMKILLDFCMIPSTEDKSCPDYHIEYSFRYLQCPLELTQKLTPGQEVQYEPLSI
LNVMVQHSRIELLNHPVCKEYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVINIKPGTA
FNSTGIINETHDHLEILDTTKKNYFLDYNNVLEWIIYTKSIIFVLPLFVNIPAYVQWQCG
AIAIFFYWMNFLMYLQRFENCGIFIVMLEVIFKTLLRSAGVFIFLLLAFGLSFYVLLNEQ
DPFSSPLLSLIQTFTMMLGDVNYRVAYLEPFLKNELAYPILSFAQLIAFTMFVPIVLMNL
LIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSIVVYPNRPRYGSM
LRLFRYFFGIQEARQEIPNTDTCLELEMLKQKYRLKDLTSLLEKQHELIKLIIQKMEIIS
ETEDEDNHTSFQDRFKKEQLEQMNSKWNFVLRAFKAKPHCPKD
Download sequence
Identical sequences G5BAU5
HGL_H00000262209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]