SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262384 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000262384
Domain Number - Region: 57-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000185
Family Eukaryotic type KH-domain (KH-domain type I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262384
Sequence length 872
Comment N4BP1 (Homo_sapiens) NEDD4 binding protein 1
Sequence
MASRGVLDEFTAPAAKAALLERSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLRGSRG
AVHSAKEYIKGICEPELEERECYPKAMHCIFVGAQSLFLKSLIQDTCADLCILDIGLLGI
RGSAEAVVMARSHIQQFVKLFESNENLPSSQKDSEVKREFKQFVEARADSYTMDLLILPT
SLKKELLTLTQGEKNPFETGEDEIVEIRDALQTEFAQNAAAGPGISRDETVLQEDARNKA
GTPVSELTKQMDAVFSSSPNVVFVQPVNGLNPDETLSKERVCYKRRFSDSEERHTKKQFS
LENVQEEELLHDDKTAGNVIIDLSDPSADSENLSLDVKDTTEEMEYNILVNFFKTMGYSQ
EIVEKVIREYGPTTEPLLLLEEIEKENKRLQEDKEFSPGTMYADSSKTKSKSICGSKNEL
TTDSTPKKTQVYTQQNTIGKFSQLPFRVEAKPCTSNCKISTFRTVPTEQKHEIRGSNQSY
VCNADLETDGLSPSVAPPSPKDTNFVSRGASSHQPRIPVFHENGLQQQAETLLPNNMKAA
CEKPLGCCGPPQSKPNCPPLSPAKPLPSLPPSVTEAKLSGPSDHIDSSVTGVQRFRDTLA
ADLKHIVIDGSNVAITHGLKKFFSCRGIAIAVEYFWKLGNRNITVFVPQWRTRRDPNVTE
QHFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGIIVTNDNFREFVTESVS
WREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVSLRDMQPLLGALPNVGMFD
PGSRVPATQPASTSHQPPARTQGAPPGHWLPQQPRFPLLPLPAQRSPSETSELREALLKI
FPDSEQRLKIDQILVAHPYMKDLNALSAMVLD
Download sequence
Identical sequences G5BT81
HGL_H00000262384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]