SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262435 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262435
Domain Number 1 Region: 376-738
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.09e-128
Family Hect, E3 ligase catalytic domain 0.00000000335
Further Details:      
 
Domain Number 2 Region: 14-134
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.75e-21
Family PLC-like (P variant) 0.039
Further Details:      
 
Domain Number 3 Region: 288-328
Classification Level Classification E-value
Superfamily WW domain 0.000000000000428
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 150-189
Classification Level Classification E-value
Superfamily WW domain 0.0000000000147
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 242-283
Classification Level Classification E-value
Superfamily WW domain 0.00000000025
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262435
Sequence length 745
Comment SMURF2 (Homo_sapiens) SMAD specific E3 ubiquitin protein ligase 2
Sequence
MYDMELMFDEYEFEVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQ
HYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPN
DNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTT
QWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMS
RTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGW
EIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDTECL
TVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLM
IKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYF
HFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITG
VLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIEAQFLALQK
GFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFF
DEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIP
PYESYEKLYEKLLTAIEETCGFAVE
Download sequence
Identical sequences G5BVF0
HGL_H00000262435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]