SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262519 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262519
Domain Number 1 Region: 1359-1499
Classification Level Classification E-value
Superfamily SET domain 7.33e-44
Family Histone lysine methyltransferases 0.0046
Further Details:      
 
Domain Number 2 Region: 68-168
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000535
Family Canonical RBD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262519
Sequence length 1502
Comment SETD1A (Homo_sapiens) SET domain containing 1A
Sequence
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSCSDTAAYPSGTAVVGTPGNG
TPCSQDASFSSSRQDTPTSFGQFTPQSSQGTPYTPRGSTPYSQDSAYSSSSTSASFKPRR
SENSYQDSFSRRHFSASAAPTTASTAISATTAATAVSSSSSSSSSSSSSSSSSSQFRGSD
SNYPAYYESWNRYQRHTSYPPRRAAREEPSGAPFSESTAERFPPSYTSYLPPEPSRPADQ
DYRPPASEAPPPEPPEPGGAGGGGGPSPEREEARTSPRPASPARSGSPVPETTNESVPFA
QHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSAGPGARDPGSEVPSGSGHGPCTPPP
APANFEDVVPTGNGEPGATRESPKANGQNQVMLGSAGEGTWVLGGRAGPLGYPPPPHIYD
FVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLPF
PPPQEAAYGLPYALYTQGQEGRAAYSREAYHLPLPMAAEPLPSSSVSGEEARLPPREEAE
LAEGKALPSAGTVGCVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQ
NAAKQQAKEEEKEKTKLKEPGMLSLVDWAKSGGTTGIEAFTFGSGLRGALRLPSFKVKRK
EPSEISEASEEKRPRPSTPAEEDEDDSERDKEVGEPGRPGTKPPKRDEDRGKTQGKHRKS
FALDSEGEEASQESSSDKDEDDDEEDEEDEEQEEAVDTTKKETAVSDGEDEESDSSSKCS
LYADSDGENGSTSDSESSTSSSSSSSSSSSSSESSSEEEEEEEQAAAIPSASPPPRDVPE
PLPAPVEEPEPEGAAGSPVAPLPEQEKSPSRPAGPTEEPTRSVPQLPPEPLAGPPAPPPC
LDERPSSPIPLLPPPKKRRKTVSFSAMEEVRAPEPPLAALPQAKPPGAVSRKGPRGAERT
IRNLPLDHASLVRSWPEEVSRGGRSRAGGRGRPAEEEEVEPGTDVDLAVLADLALAPALA
LAQRSLAALPPGDDSEATETSDEADRLGPPLSHIFLEHNYALAVKPTPSTPAPRPPEPVP
APAALFSSPADEVLEAPEDGPREHQTGSARSEGYYPISKKEKDKYLDVCPVSARQLEGVD
TQGTNRVLSERRSEQRRLLSAIGTSAIVDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAM
EPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFI
NHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDSKIPCLCGAESCRGS
LN
Download sequence
Identical sequences G5BYD3
HGL_H00000262519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]