SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262547 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262547
Domain Number 1 Region: 605-682
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000746
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262547
Sequence length 734
Comment C20orf12 (Homo_sapiens) Ankyrin repeat-containing protein C20orf12
Sequence
MTAGSVCVPQIIPLRIPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKKIGY
GENNTFKYTKPITLPDGKIQVKAIAVSKDNRQSGIVTKVFQVDYEPPSPASSGDRVENVL
KGSSKQANLKVGERSTLLKALRDLRFSKSPLEISAHCEGSSSRLLTHQSQSPGFAHIPGQ
KSLTSTEIMRIQRQTDFLKCAHCLAPRPSDPFARFCHECGAPVPSIFGCRLPPPEGAQMG
SCAECGNVVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRSCGTGNPAHLRYCVTCEG
ALPSPQESWNSGEKAPPLLTQKGETTSWCRWACHNLGEAIFCDWCGAKLGLSASHSICPK
CGASNHPSAQFCATCGVCVNSMARQSLDGSPTVLAGEPHPTSQPRYAWQPLTVPLPSADA
GPKKHVGTQTVGLFYPSGRQLALKEPEVETRGRMPPLMAISPGRGYWRKQLDHISAHLRS
YTQNNPEFRALVSEPRMGKLISATVHEDGCEVSIRLNYIQVSNKNLYLSKAMDLSNRFLS
SITEGGDGLYGSRSSLVSDYSQSPSDSEVKRMRNIKTKNFHIKKEQPRPRSRHRVEEVGL
AGDKRVSVLEQLLDKDTDPDCSDSTGRSAAALNKHQEAIPVLTGRGVDVDQQWGLYSTSL
QKVDTRGQTAHNLALEREDHHVTLLFDAKFSQELGDQLSQPESCSPDDCQAQGSCWSSQK
EPLSTGCPVSEVCI
Download sequence
Identical sequences G5CBB0
HGL_H00000262547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]