SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262650 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262650
Domain Number 1 Region: 527-894
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.79e-137
Family Hect, E3 ligase catalytic domain 0.00000000000923
Further Details:      
 
Domain Number 2 Region: 17-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.18e-24
Family PLC-like (P variant) 0.000000935
Further Details:      
 
Domain Number 3 Region: 431-469
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000556
Family WW domain 0.00041
Further Details:      
 
Domain Number 4 Region: 355-389
Classification Level Classification E-value
Superfamily WW domain 0.00000000000148
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 322-355
Classification Level Classification E-value
Superfamily WW domain 0.00000000000278
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 472-507
Classification Level Classification E-value
Superfamily WW domain 0.0000000000108
Family WW domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262650
Sequence length 900
Comment ITCH (Homo_sapiens) itchy E3 ubiquitin protein ligase homolog (mouse)
Sequence
MSDSGSQLGSMGSLTMKSQLQITVLSAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNT
NSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAAVDIYETLKSNNMKLEEVVVSL
QLIGDKEPTETIGDLSVCLDGLQLEAEGVTNGETTSSESECSLSSSFMILLIPNSYCNKN
AITLKLIFCLNFIDIKDASQNDDDSRPKDETRVNTNESGDTEDAGSGENKRVNGNNSPSL
SNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSATSESDGSSTGSLPPTNTNTNTSEGTTS
GLIIPLTISGGSGPRPLNPVTQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPG
WERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQ
DLFAASQNKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEG
WEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLA
MPQHIKITVTRKTLFEDSFQQIMSFSSQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHE
VLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPF
YKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPN
GGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLC
GMQEIDLNDWQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFA
DLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE
Download sequence
Identical sequences G5BPT5
HGL_H00000262650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]