SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262866 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262866
Domain Number 1 Region: 91-194
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-30
Family SH2 domain 0.0000613
Further Details:      
 
Domain Number 2 Region: 9-91
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000131
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262866
Sequence length 261
Comment SLA2 (Homo_sapiens) Src-like-adaptor 2
Sequence
MGSLPSRRKTLPSPSVIPCVQAQGPEPLQAERCQATAVALGSFPAGGQAELSLRLGEPLT
IISEDGDWWTVLSQVSGREYSVPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI
WESQTRRGCYSLTVRLSRPASWDQIRHYRIQCLDNGWVYISPRLTFPSLQDLVDHYSELA
DDICCLLKEPCALQRCGSLPVKDIPLPVTVQRTSLNWKELDSSLLFSEGPTTGEASLLSE
GLRESLSSYISLTEVVSLDDA
Download sequence
Identical sequences G5B833
HGL_H00000262866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]