SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262970 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262970
Domain Number 1 Region: 24-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-52
Family Ankyrin repeat 0.00019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000262970
Domain Number - Region: 646-733
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0027
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262970
Sequence length 1016
Comment ANKRD24 (Homo_sapiens) ankyrin repeat domain 24
Sequence
MKQLCLCAATSLAGQDWSKSDERLLQAVENNDSARVAVLISRKGLVPTKLDPEGKSAFHL
AAMRGAASCLEVMLAQGANVMSTDGAGYIALHLAAKYGHPQCLKQLLQASCVVDMEDSSG
WTALHHAAAGGCLSCSELLCSFKAHLNPRDRSGATPLILAAQMGHTDLCRLLLQQGAAAN
DQDLQGRTALMLACEGASPETVEVLLQGGAQLGITDALGQDAAHYGALAGDKLILHLLQE
AARRPSPPSEEDSGEASSQNSVSSHEKREGPKKRKAPQPPAHIPMPDDREAYEEIVRLRQ
EKGRLLQKIRGLEQHKERRKHEPQEAEASSVHSLERQVQELQQLLAEKEEEKESLGREVE
SLQSRLSLLESERENTSYDVVTLQDEEGDLPDFPGAETPLSRQLSPSAQEHLALLQEQVA
ALTRQNQELLEKLQILENFEKDDTQVAGDGLSEVVPLVLYDSLRAEFDQLRRQHAEALRA
LEQQEAREVPRREEDKDMGASATPNRPPNPKLNFTMVPETRINGAERADDAAGGDAAPAE
HEVTGTEGAGAEAEGNKGTEAKEMEAGEEGENMETDTTGGAAMASEATGSEVTRMEPETK
TNAAGAREAKLTPNMEATGSKATAPRVPAGPILHPGAAEASEKLQSELETRIRSLEEVLR
QREREAAAELEAARGKWEAAEAEAGRLRERVREAQGVGARGVSNGGSGSGDTVQLRAALE
QAREDLRERDSRLQELEAAAAWLDEARAGQLLAEEEARATACEEARRGLAELREASEALR
QSSVPVSEHHRLQEEALELRAQAASLEQEVVATGKEAARLRAELEQERVGSVALSEHERV
VGALRANVARLEGQLEELARRHEKTSAEVFQVQREALFMKSERHAAEAQLATAEQQLRGL
RTEAERARQAQSLAQEALDKAKEKEKKITELSKEVFSLKEALKEQRAAGASPEVEALRDQ
VKAMQRQMEDATRDHCAVVALYRTHLLYAIQGQMDEDVQRILTQILQMQRLQAQGR
Download sequence
Identical sequences G5BZB1
HGL_H00000262970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]