SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262992 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000262992
Domain Number 1 Region: 44-183
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000309
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262992
Sequence length 925
Comment INPP4B (Homo_sapiens) inositol polyphosphate-4-phosphatase, type II, 105kDa
Sequence
MEIKEEGTSEEGQQFLPTAQANDTGDTQFTSIQKSPNEPQLEFILACKDLVAPVCDRKLN
TLVQISVIHPTEQSLTRYSSTEIVEGTRDPLFLTGVIFPSEYPIYEETSIKLTVYDVKDK
SHDTVRTRVLSEHNKDSPPEVGRSFLGYASFKVGELLKSKEQLLSLSLRTSDGGKVVGTI
EITVVKMGEIEDGEAGHITTDVQGQKCALVYECTAPESVSGKDNLSFLNAVLKNPVCKLY
RFPTSDNKWMQIREQMSESILSFHIPKELISLHIKEDLCRNQEIKELGELSPHWDNLRKN
VLTHCDQMVNMYQDILTELSKETGSFKSSSSKGDKTLEFVPINLHLQRMHVHSPHLKDAL
YDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGG
ILKKPPSPKSSAEESHPQDQPPPMRRQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVD
QLIERDGSSEGSGSGDNDGEKDPSLADSITSHPTEDWYEQLHPLILTLKDCMGEVVSRAK
QSLTFVLLQELAYSLPQCLMLTLRRDIVFSQALAGLVCGFIIKLHTSLHDPEFLQQLHTV
GLIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAKSNDVLPVITGRREHYVVEV
KLPARMFESLPLQIKEGQLLYVYPVLFNVGINEQQTLAERFGDVSLQENINQENFELLKE
YYRVFMEKMPPDYISRFQEQNDLKGLLENLHQNIQAKKRKNVEIMWLAATICRKLNGIRF
TCCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYA
FNMLQLMAFPKYYRPPEGTYGKADT
Download sequence
Identical sequences G5BLT3
HGL_H00000262992 XP_012922587.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]