SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263125 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263125
Domain Number 1 Region: 376-679
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-97
Family Protein kinases, catalytic subunit 0.00000000002
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.7e-23
Family PLC-like (P variant) 0.0000385
Further Details:      
 
Domain Number 3 Region: 214-284
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.72e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 
Domain Number 4 Region: 142-210
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.38e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263125
Sequence length 705
Comment PRKCQ (Homo_sapiens) protein kinase C, theta
Sequence
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNMDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNAR
YFLEMNTKDLSEFEAEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVW
GLNKQGYQCQQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKS
PTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGVNQKLMAEALAMIESTQQA
RSLRDSEHIFREGPVEIGLPCSVKNEARPPYLATTGKKEPQGISWDSPLDETDKVCHQPE
PEPNIERPTLYMKLKIDDFMLHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDD
VECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLPRA
TFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDARTNTFCG
TPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRW
LEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYDC
SNFDKEFLNEKPRLSFADGALINSMDQNMFRNFSFVNPGMEGLIS
Download sequence
Identical sequences G5BP89
HGL_H00000263125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]