SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263246 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263246
Domain Number 1 Region: 23-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-72
Family FCH domain 0.0023
Further Details:      
 
Domain Number 2 Region: 427-485
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-20
Family SH3-domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263246
Sequence length 486
Comment PACSIN2 (Homo_sapiens) protein kinase C and casein kinase substrate in neurons 2
Sequence
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWVSFMSEAERVSELHLDIKASLMNEDFEKIKNWQKEAF
HKQMMGGFKETKEAEDSFRKAQKPWAKKMKEVEAAKKAYHAACKEEKLAISREANSKSDP
SLNPEQLKKLQDKIEKCKQDVLKTKDKYEKALKELDQSTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNTASYKTIYHDLEQSIKAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKAGDGVTLTGISQTADQAVPNKASSNLSVPSNPVQPAQSQSS
YNPFEDEDDTGSTISEKEDIKTKNVSSYEKTQSYPADWSDDESNNPFSSTDANGDSNPFD
EDTASGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPAN
YVEAIQ
Download sequence
Identical sequences G5BPS6
XP_012927978.1.39548 HGL_H00000263246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]