SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263269 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263269
Domain Number 1 Region: 327-355,389-493,615-730
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.05e-55
Family Phosphate binding protein-like 0.000000102
Further Details:      
 
Domain Number 2 Region: 6-321
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.24e-16
Family L-arabinose binding protein-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263269
Sequence length 797
Comment GRIN2D (Homo_sapiens) glutamate receptor, ionotropic, N-methyl D-aspartate 2D
Sequence
SLVLQLCDLLSGLRVHGVVFEDDSRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEK
GSTFLQLGSSTEQQLQVIFEVLEEYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEH
RGALTLDPGAGEAVLSAQLRSVSAQIRLLFCAREEAEPVFRAAEEAGLTGAGYVWFMVGP
QLAGGGGSGAPGEPLLLPGGAPLPAGLFAVRSAGWRGALSITQKVPSGRLTVLLGPRSTD
FIHQQGPGNGKGVCPTQVPSQPLLSLGRYFMNITWDNRDYSFNEEGFLVNPSLVVISLTR
DRTWEVVGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIVEPADPISGT
CIRDSVPCRSQLNRTHSPPPDAPRPEKRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHG
KKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSP
SAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIW
LLWALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLS
DRKFQRPQEQYPPLKFGTVPNGSTEKNIRSNYPDMHSYMVRYHQPRVEEALTQLKAGKLD
AFIYDAAVLNYMARKDEGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDD
EIEMLERLWLSGICHNDKIEVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLR
HCLGPTHRMDFLLAFSR
Download sequence
Identical sequences G5B8A7
HGL_H00000263269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]