SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263388 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263388
Domain Number 1 Region: 1615-1860
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.99e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 761-891
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000151
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 3 Region: 1072-1213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000196
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 570-693
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000212
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 393-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000232
Family EGF-type module 0.002
Further Details:      
 
Domain Number 6 Region: 473-587
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 432-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000343
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 353-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000482
Family EGF-type module 0.00072
Further Details:      
 
Domain Number 9 Region: 199-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000139
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 887-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000099
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 11 Region: 1043-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 925-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000482
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 237-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 14 Region: 161-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000312
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 15 Region: 698-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000625
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 1429-1462
Classification Level Classification E-value
Superfamily Notch domain 0.0000000732
Family Notch domain 0.0035
Further Details:      
 
Domain Number 17 Region: 274-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000171
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 18 Region: 1210-1256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 1300-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000025
Family EGF-type module 0.026
Further Details:      
 
Domain Number 20 Region: 316-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 964-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family EGF-type module 0.014
Further Details:      
 
Domain Number 22 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000005
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 23 Region: 4-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000625
Family EGF-type module 0.038
Further Details:      
 
Domain Number 24 Region: 1350-1382
Classification Level Classification E-value
Superfamily Notch domain 0.0000012
Family Notch domain 0.0012
Further Details:      
 
Domain Number 25 Region: 82-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000267
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 26 Region: 1390-1422
Classification Level Classification E-value
Superfamily Notch domain 0.0000034
Family Notch domain 0.004
Further Details:      
 
Domain Number 27 Region: 736-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000449
Family EGF-type module 0.043
Further Details:      
 
Domain Number 28 Region: 1011-1051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000464
Family EGF-type module 0.046
Further Details:      
 
Domain Number 29 Region: 41-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000263388
Domain Number - Region: 1254-1289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00578
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263388
Sequence length 2156
Comment NOTCH3 (Homo_sapiens) notch 3
Sequence
APACLDGSPCANGGRCTQLPSQEAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVA
GTARFSCRCPRGFRGPDCSLPDPCLSSPCAHTARCSVGSDGRFVCSCPPGYQGRSCQSDM
DECRCRVAGLCRHGGTCLNMPGSFRCQCPGGYTGPLCEDPTVPCAPSPCRNGGTCRQSGD
LTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDE
CQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFY
CACPMGKTGLLCHLDDACVSNPCHEDAVCDTNPVNGRAICTCPPGFTGGACDQDVDECSI
GANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCIC
MAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGTTCQLDVDECASTPCK
NGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFTCACVPGYTGT
RCESQVDECRSQPCRHGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDG
INRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCLDVENGFRCLCPPGSLPPLCLPPSH
ACAHEPCSHGVCHDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRGGGTCVSDRMSFH
CTCPPGVQGRQCEVLSPCTPNPCEHGGRCESAPGQPVVCSCPTGWQGPRCQQDVDECASS
APCGPHGTCSNLAGSFSCTCHGGYTGPSCDQDIDDCDPNPCLNGGSCQDSVDSFSCSCLP
GFAGPRCARDVDECLSSPCGPGTCTDHVASFACTCPPGYGGFHCEKDLPDCSPSSCFNGG
TCVDRVNSFSCLCRPGYTGAHCQYEADPCLSRPCLNGGVCSTTHPGFHCACLEGFAGSQC
QTLVDWCSQAPCQNGGHCVQTGAYCLCRPGWSGRLCDIRSLPCKEAAAQIGVRLEHLCQA
GGQCVDKGSSHSCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECPAGYSGD
NCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPSLDLRPRCL
HNGTCVDLVGGFRCNCPPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGRFHCLCHTG
FTGPRCQTALSPCESQPCHNVGQCRPSPGPGGVLTFICHCVQPFWGPHCEHVARPCRELQ
CPRGVPCQQTPRGPRCACPPGLSGLPCRSRAVPPGGTNASCAAAPCLHGGSCRPAPLAPF
FRCGCAPGWAGLRCETPAAAAAPEVAEEPQCPRAACQAKRGDRRCDRQCNTRGCGWDGGD
CSLNVDDPWRQCEALQCWRLFNNSRCDLACSSPACLYDNFDCHGRERTCNPVYEKYCADH
FADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLMPPEELLRSSADFLQRLSAI
LRTSLRFRLDSRGQAMVFPYHRPSSASESRTRRELAPEVIGSMAKGESLMGEVATDWMDT
DCPEAKRLKMEEPGVGAKEPVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNV
RGPDGFTPLMLASFCGGALEPVPAEEEEVEDTSASIISDLICQGAQLGARTDRTGETALH
LAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMA
DGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGAN
KDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLL
DQPSGPRSPPGPHGLGPLLCPPGAFLPGLKTAPSGTKKSRRPPGKAGLGPQGTRGRGKKL
TLACPGPLAESSVTLSPVDSLDSPRAFGGPPASPGSFPIEGPYAAATATAVSLAQLGGPG
RAGPLGRQPPGGCVLSLGLLNPVAVPLDWARLPXXXXXFLLPLAPGPQLLNPGAPVSPQE
RPPPYLAAPGHGEEYPASGTQSSPPKPRFLRVPSEHPYLTPSPESPEHWASPSPPSLSDW
SDSTPSPAIAAGATATAAAAGLPSQPHPLSIPGSLGQAQTQLGPQPEATPKRQVLA
Download sequence
Identical sequences G5BYQ0
HGL_H00000263388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]