SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263405-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000263405-1
Domain Number - Region: 453-503
Classification Level Classification E-value
Superfamily SH3-domain 0.000121
Family SH3-domain 0.0016
Further Details:      
 
Domain Number - Region: 378-458
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.0262
Family Oxysterol-binding protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263405-1
Sequence length 612
Comment FYB (Homo_sapiens) FYN binding protein
Sequence
MDGKADVKSLMEKFNTGSNLAEEVSGNNQPFKATAQNSPLGIQARKNLFDNQENVNPPTG
PSNMPKFGTPKPPLAVKPTFEEKPDEEPKPPFVKPSGVNQRFGTLSNLATREPDIKMGFP
KPGGLKAINLPKEDSKPVFPRPPGNKSSLHSVNQDQDMKTPGPKPGTVPPAPESEQRLAF
PRLAGAKGKFTSASPDHDAKPLFPKPIIGQKPALGMENSHEDESLTKNMSAQKGSPTPLG
AKSKGGSLKPTREDPENKGHGSDASSSPFTGVVLKPAGSRGSPGLSRNGEENKEYRKIYA
TKNIFLSKVNQEESTKFPKPPSKLTVGGPWGQSQEKEKEDKNPAIPKQKPLPPLSTLGPP
PPKPSRPPNVDLTKFRKADSANSTSKSQTSYSTTALPPTPPSQRGSTGNLEEDQDSEVET
YEDIEASKEQDKKWEKEEKKRIELERKEQKEKEKKEQELRKKFKLTGPIQVIHQAKACCD
VKGGKNELSFKQGEESEIIQIDYDSLKRKKSSFTTVSSRPIEDDQKVYDDVAEQDASNSQ
SQSGSGGVFPPPPDDDIYDGIEEEDANDGFPSPPKQLEVEEEVYDDVDASDFPALPAEMS
YGSSTGKAKTED
Download sequence
Identical sequences G5ANU4
HGL_H00000263405-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]