SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263405-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263405-2
Domain Number 1 Region: 498-572
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000131
Family SH3-domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263405-2
Sequence length 733
Comment FYB (Homo_sapiens) FYN binding protein
Sequence
MDGKADVKSLMAKFNTGSNLAEEVSGNNQPFKATAQNSPSGIQARKNLFDNQGNVNPPTG
PSNMPKFGTPKPPLAVKPTFEEKPDKEPKPPFVKPSGVNQRFGTLSNSATREPDIKMGFP
KPGGLKPINLPKEDSKPVFPRPPGNKSSLHSMNQDQNMKTPGPKPGTAPPAPESEQRLAF
PRLAGAKGKFTSASPDHDAKHLFPKPIIGQKPALGTENSHEDENLTKNMSAQKGSPTPLG
AKSKGGSLKPTREDPENKGHGGDASSSPFTGVVLKPAGSRGSPGLSRNGEENKEYRKIDA
TKNIFLSKVNQEESTKFPKPPSKLTVGGPWGQSQEKEKEDKNPAIPKQKPLPPLSTLGPP
PPKPSRPPNVDLTKFRKADSANSTSKSQISYSTTALPPTPPSQSASQPPLPASHLSQPPA
PSLPPRNIKPPFDPKSPVNEENQDGVMHSDGTGNLEEDQDSEVETYEDIEASKEQDKKWE
KEEKKRIELERKEQKEKEKKEQELRKKFRLTGPIQVIHQAKACCDVKGGKNELSFKQGEE
IEIIRITDNPEGKWLGRRARGSYGYIKTTAVEIDYDSLKGKKSSFTTLSSRPIEDDQEVY
DDVAEQDSSNSQSQSGSGEGVFPPPLDDDIYDGIEEEDANDGSTLQVEEKSSKWSWGILK
KLKGKDDKKKSIREKRKVSESDNNEGSSFPSPPKQLEVGEEVYGDVDASDFPALPAEMSY
GSSSGKAKTRLRS
Download sequence
Identical sequences G5BLT1
HGL_H00000263405-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]