SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263433 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263433
Domain Number 1 Region: 180-387
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.54e-48
Family Ankyrin repeat 0.000000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263433
Sequence length 842
Comment PPP1R12C (Homo_sapiens) protein phosphatase 1, regulatory (inhibitor) subunit 12C
Sequence
MRTPFPSVPWGGSVTSRPGRGRDSLGGVGQTAVPGGPRGGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALLMLRAAEPGSCAEPDPDPAAPPPALAVL
DSTNADGISALHQACIDENLEVVRFLVEQGATVNQADNEGWTPLHVAASCGYLDIARYLL
SHGANIAAVNSDGDLALDLAESDAIEGLLQAEIARRGVDVQAAKRAEEELLLHDTRCWLN
GGAMPEARHPRTGASALHVAAAKGYIEVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVED
ACRLLAEHGGGMDSLTHAGQRPCDLADEEVLSLLEELAQKQEDLRHQKEAGRSRGQEPQV
PSSSKHRRSSVCRLSSREKISLQDLSKERRPGGAGGPPIRDEEEGEEGHPEPPPAEPRAL
NGVSSPPLASPPSPVXXGAEAATGAGLQRSASSSWLEGTLAQAREPCLAGIPPTLSRKTP
EPCPLSGVARPPPTLDNCTPPSSRELGSPAKPNVPPASTPAPADSRDRRRSYQMPARDEE
SESQRKARSRLMRQSRRSTQGVTLTDLKEAEKVAGKSTEAAKLSLRGLDPSPRPRVPGVE
NSEGPARRAEAPDGQGQGPQTAREPRKAGRERWGPAEGEEAEPEEHSSECSNRVDALVAR
RPRPKQNLTPEPELKPEEPDGGFRKLYSELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALEHKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
Download sequence
Identical sequences HGL_H00000263433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]