SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263549 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263549
Domain Number 1 Region: 401-582
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.63e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 268-368
Classification Level Classification E-value
Superfamily WWE domain 0.000000000012
Family WWE domain 0.013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000263549
Domain Number - Region: 200-235
Classification Level Classification E-value
Superfamily WWE domain 0.0968
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263549
Sequence length 627
Comment PARP12 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 12
Sequence
MIYGACKFLRIGKNCRNSHSLMTDHNLSVLRTHGIDHLTYSELCQLLFQNDPMLLPEVCL
HYNKGDGAFGGCSFQKQCIKLHICQYYLQGECKFGTSCKRCHDFSSSENLEKLEKLGMSS
DLVSRLPSIYRNAHDIKNKSSAPTKALPPPASLQGTSERRDSSGSVSPNTPSQEETDQIC
LYHIRKSCTFQDKCHRVHFHLPYRWQFLDGGKWKDLDKMELIEEAYSNPKRDRIVCAGPG
HGQADALNFNSMKFGTAQARRLSTASSVTKPPHFILTTDWVWYWNDEFDSWQEYGKQGTV
HPVTTINSSDVEKAYLAFCTPGADAQAAILKFQAGKHNYTLDFKAFVQKNLAYGTVRTVC
RRPKYVSPQDVQTKQTCSVKFQGPKSIPDYWDPSALPDPGFKKITLNSSSEEYQKVWNLF
NRTLPYCFVQKIERVQNLALWEVYQWQKGQMQKRNEGKEVDERQLFHGTATSFVDAICQQ
NFDWRICGLHGTSYGKGSYFARDAAYSHHYSKSDTHIQMMFLARVLVGDFVRGNPSLVRP
PAKDGQSNTFYDSCVNSVSDPSIFVVFEKHQAYPEYLIQYSTSPKPPAGAVSXXXXXXXX
XXXXXXXXXXXXCHWELHAGGGAGFPL
Download sequence
Identical sequences G5B562
HGL_H00000263549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]