SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263657 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263657
Domain Number 1 Region: 159-252
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263657
Sequence length 254
Comment PNO1 (Homo_sapiens) partner of NOB1 homolog (S. cerevisiae)
Sequence
MAEMAEMETQTAGAEEGFTQVTRKGARRAKKRQSEHLSKAGEDGDVARMDTEEARPAKRP
VFPPLSGDGLLSGKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEI
RTCKETKDVSALTKAADFVKAFILGFQVEDALALVRLDDLFLESFEITDVKPLKGDHLSR
AIGRIAGKGGKTKFTIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVY
GNIRAVASRSADRF
Download sequence
Identical sequences G5BA15
XP_004850002.1.39548 HGL_H00000263657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]