SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263674 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263674
Domain Number 1 Region: 1053-1264
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-53
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 1730-1970
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000916
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1256-1353
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000652
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263674
Sequence length 2055
Comment ARHGEF17 (Homo_sapiens) Rho guanine nucleotide exchange factor (GEF) 17
Sequence
MADGSPRPPLYRSVSFKLLERWSGGPGPKVEDADSPGLRRRTSCRPAAAVLGQPSRRVSK
LASGPPAAPAQPRPLRSLSPSVRQLSRRFDAPRPDCDSAGTRDGGVSPGAAEEAAEGAAR
GAWPSVTEMRKLFGGPGSRRPSAESEASGTPTPDGASWEPRQPPTRPPRTCFPLAGLRAA
PRPLPGPGMEGRRRQQLLERAQRPADGLHSWHSFSQPQAGARASCSSSSSSSVVSSYPVS
RSRAASSSEEEEEGPPLPPGSQSPAYHGGRSSGSEEDQDGEGSHHWRRPGFSPGNALLDQ
DYGPDSDGLNLGSMDSAGVVRSPEPPASPRRVHSEEGPPEWGSGLQPCVSGPQEGMRPMS
DIVGGAFRLAKVSFPAYLASPGGSRGSSRYSSTETLKDDDLWPSRGSGSWGLYRSPSFGA
GEGLLRPQPRSRTKGPVSITRALRDGELELDKSRQRKSLSNPDIASETLTLLSFLRSDLS
DLRVRKPSVGPGSSPVDGRDSTSAGGLVEQIEPVPSQAPASPGTRPTLKDLTATLRRAKS
FTCSEKPVARRLPRTSPLKPSSSELLLAGLGVEEDPPPLVVQDQYVQEARQVFEKIQRMG
AQQDDGSDVPPRSPDWAEDMTRGQRSQEELSGPESSLADEGIGADPEPPGVAFSSLGTAG
VWRPLSSSAQMNRHASGAEDSLGGWALMSPETPTTPGALRRRRKVPPSGPGGAELSNGEA
SEAYRSLSDPIPQRHWAATSEEPSGFSVDSNLLGSLSAKAGLPVTPAVDEGLTSGHSDWS
VGSEESKGYQEVIQTIVQGPGTLGCIGEDRVAGKAPKKKSLSDPSRRGELAGPGFEGPGG
EPIREVEPVLPPSSSEPILSEQRAEPEDPGPARSRAQSERALPEALPESTAHHAFHLDPK
LADILSPRLIRRGSKKRPPRSSHQELRKEERDQDQNGGLSQVRPSSKHVRHASVPAIFMP
IVVPEPQTSVDPIVAVPEPVGLPAQVHPTLQAPSLEDVTKQYMLTLHSSEVPAPVSVDLP
CLTPVAPPSAEARLPEATRAPDEPASASKCCRKPQVDMRKHVTMTLLDTEQSYVESLRTL
MQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCVQTWHAQQKVGSLL
VQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKETRPAFLKFLEQSMRENKEKQALSDLMIK
PVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEEAERHARVL
QEIEAHIEGMEDLQAPLRRFLRQEMVTEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLR
RSSMSLYTAASVIDTASKYKMLWKLPLEDADIIKGASQATNRENIQKAISRLDEDLTTLG
QMSKLSESLGFPHQNLDDVLRDLSAAMHRDLSEKQALCYALSFPPTKLELCATRPEGTDS
FIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTLSS
CPDPTPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGLQPRCHREHP
ESLRNPPETAPEPAGQELDIEAAAEEEAVTMAEPGSQPCLHISISGSGLEMAPGPTEGDS
RPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETTSSEEEQEP
GFLSLSGSFGPNGPCGTSPMDGRALRRSSHGSFTRGSLEDLLSVDPEAYQSSVWLGTEDG
CVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQRETGRFWDPQN
FKSVTLGAQGSPITKMVSVGGRLWCGCQNRVLVLSPDALQLEHTFCVGQDSSRSVACMVD
SSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALL
VCEELLWVGTSAGVVLTMPTSPSTVSCPRAPLSPAGLGQGHTGHVRFLAAVELPDGFNLF
CPTPPPPSDTGPEKLPSLEHQDSPRHRPPTSARPKMLVISGGDGYEDFRLSSGGSGSSET
VGRDDSTNHLLLWRV
Download sequence
Identical sequences G5ASA6
HGL_H00000263674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]