SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263734 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263734
Domain Number 1 Region: 236-338
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.34e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000189
Further Details:      
 
Domain Number 2 Region: 87-193
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000877
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 3-65
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000124
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263734
Sequence length 862
Comment EPAS1 (Homo_sapiens) endothelial PAS domain protein 1
Sequence
RSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHK
LLSSVCSENESEVEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTG
HSIFDFTHPCDHEEIRENLTLKNGSGFGKKVKEMSTERDFFMRMKCTVTNRGRTVNLKSA
TWKVLHCTGQVKVYNSCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRH
SMDMKFTYCDDRITELIGYHPEDLLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYR
MLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHVM
AMNSIFDSSDERAASEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFKESSAFG
KAILPPGQPWAAEVRSHSAQSEAGSLPAFTVPQVAAPGSSTPSTTSSSSCSTPSSPGDYY
TSLGDDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEE
PHLPESLQPTPQPCFSAMTSIFQPLAPMACHSPFLLDKYRQQLEGKKTEPDHRPMSSIFF
DAGSKGSLPSCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWPGGEPHTECLGTSPLEH
PIASPHVSMFKMRSAKGCGPRGPDVMSPAMIALSNKLKLKRQLEYEDRAFQDSSGGDSPG
SSSSHLMWKRIKRLRSGPGPLVPDKPLRNVHVPADEFNKNSLRGLSQPLRHLPPPQPPSA
VSPAENAKGGFPPQCYAAAYQDYSLPSTHTVSGIASRLLGPSFEPYLLPELTRYDCEVNV
PVPGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences G5C9T6
HGL_H00000263734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]