SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263736-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263736-2
Domain Number 1 Region: 228-556
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.96e-52
Family Tex N-terminal region-like 0.00035
Further Details:      
 
Domain Number 2 Region: 558-706
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.1e-40
Family Tex RuvX-like domain-like 0.0000502
Further Details:      
 
Domain Number 3 Region: 707-795
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.85e-26
Family Tex HhH-containing domain-like 0.00049
Further Details:      
 
Domain Number 4 Region: 934-1019
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000418
Family Cold shock DNA-binding domain-like 0.0014
Further Details:      
 
Domain Number 5 Region: 847-924
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000667
Family Tex HhH-containing domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263736-2
Sequence length 1069
Comment SRBD1 (Homo_sapiens) S1 RNA binding domain 1
Sequence
MALSLPGLTAPLSLLRVRLEETRRDFRLLKNFRREPEDAVKHRIPGPLTSRAPRSSASEE
DDKEDSVWEPQKKVPRARKQPAAKESKPKRMPRGKKNITLKSGGSEGVAVKEELNRSIAI
ADVDLEENKLNTAQTLKTAKTKQKNSAQRMKKLKVAEETSEVSNLAGESNSTEIPSTSTM
VEGVCKKEENEDDFTFGQSPLKRMKTEMCPQGQPVKFPASANTIKEEVEMNWDIVQVLSE
RTNIELWVCANIIRLFNDDNTIPFIVRYRKELINNLDADSLREVRQTLEELRAIAKKVHS
TIQKIKKEGKMSECLLKALLNCKSFEELEHVSAPYKTGSKGTKAQRAKQLGLETAAWTLL
ENPGKLNLLSYIRPDVKGLSALQDIETGVQHILADMIAKDKDTLDFIRKLCPSSSAFYIT
YFLSIAVIHGDTGYCSAFEEIEKRFGPFDLAAIPIGAYEPRWFMKYQRVNPEEAVRIHID
VQAKKSVAVHWGTFALAYEHYLEPPVKLSEALERYGLRTEDFFVLKHGESRAKLTSDAEK
ESVMMFGRNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQILHTDVVYLHCGQGF
REAEKIKRLLLNFNCSTVVIGNGTACRETEAYFADLIMKNYFAPLDVVYCIVSEAGASIY
SVSPEANKEMPGLDPNLRSAVSIARRVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATL
DSVVEECVSFVGVDINICSEVLLRHIAGLNTNRAKNIIEWREKNGPFINREQLKKVKGLG
PKSFQQCAGFIRINQDYIRTFCSSQQTESLSHIQGIAVTPSAGVEVAHEKQGKKKNKTSV
DAMLKPNPLDQTCIHPESYDIAMRFLSFIGGTLCEIGKPEMKQKINSSLEKEGIEKAAER
LTTTVQTLQIVIDGLSQPESFDFRTDFDKPDFKRSIVCLEDLQVGMILTGKVENATLFGI
FVDIGVGRSGLIPIRNVTEAKLSKTKKRRSLGLGPGERVEVQVLNIDIPRSRITLDLIRV
FPPKTLSSGCTSIQERTLDIQSCGEISAAHGVFGCCVIDTGSCWNRTWT
Download sequence
Identical sequences G5C9T9
HGL_H00000263736-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]