SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000263846 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000263846
Domain Number 1 Region: 87-218
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.99e-42
Family Synaptotagmin-like (S variant) 0.0004
Further Details:      
 
Domain Number 2 Region: 222-367
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.69e-37
Family Synaptotagmin-like (S variant) 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000263846
Sequence length 369
Comment SYT7 (Homo_sapiens) synaptotagmin VII
Sequence
GKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVDTALVPGQTPHDESDRRTEPRSSVS
DLANSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKILKAQELPAK
DFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLD
YDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIV
NIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEK
LRETTIIITVMDKDRLSRNDVIGKVGAARPPGLPCCIPGTSWGPRFCRHWKDMIARPRQP
VAQWHQLKA
Download sequence
Identical sequences G5AYF9
HGL_H00000263846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]