SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264144 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264144
Domain Number 1 Region: 579-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000446
Family Laminin-type module 0.0003
Further Details:      
 
Domain Number 2 Region: 91-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 524-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000121
Family Laminin-type module 0.00083
Further Details:      
 
Domain Number 4 Region: 147-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 5 Region: 207-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000264144
Domain Number - Region: 711-799
Classification Level Classification E-value
Superfamily Tropomyosin 0.00203
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 441-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00218
Family Laminin-type module 0.091
Further Details:      
 
Domain Number - Region: 931-1140
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264144
Sequence length 1253
Comment LAMC2 (Homo_sapiens) laminin, gamma 2
Sequence
MPVLWLSCLCLSFLLPAAGATSRREDEEDDTQRGMLTTMLSQLAIGELCSSKHNSFVEWK
IEAPKSDCLDQRHTVRNSAMFQLPDECYQVCDCNGKSNQCIFEEELHWRTGNGLRCLNCK
DNTDGLHCERCREGFYWHQDRDHCLPCNCHSKGSLSPQCDNSGRCSCKPGVTGDKCDQCL
PGFHMLTDAGCTQDQRRLAFKCDCDPAGLAGPCDSGHCVCKPAVTGERCDRCRPGYYHLD
AGNPEGCTQCFCYGHSASCRSSTDYSVHKITSTFQRDVDGWKAVQRNGSSAKLHWSQRYR
NVYTSARRDPVFFVAPARFLGNQQVSYGQSLSFDYRVDRGGRHSSAHDVILEGAGLQITA
PLIPRGKILPCGITKTYTFRLNEHPSSTWSPQLSYFEYRRLLRNLTALRIRATYGEYSTG
YIDNVTLISARPVSGAPAPWVEHCICPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNC
QGGGACDPDTGDCYSGDENPEIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEE
VVCNNCPTGVTGARCELCADGYFGDPFGERGPVRPCQPCQCNNNVDPSASGNCDGLTGRC
LKCIHNTAGFNCDQCKAGYFGDPLAPSRANKCQACNCNPVGSQSGECRSDGSCVCKPGFG
GLNCEHGALSNCPACYGQVNTQMAQFMEQLQGLEALISKAQGGGGLIPNSELEGRLQQAE
QALQDILREAQISEDASRSLSLQLAKARSQENSYQNRLGDLKKTVERVQALGSQYQNRVQ
DTRRLITQMRLSLAENEAALRNSDIPPSDQYVGPNGFKSLAQEAMRLADSHVESASNMEQ
LVKKTEDYSKQALLLAGKALSEAVGSEITDNHAIQGLMGKLEKTKSLAQQLTREATQTDT
EADKSYQHSLRLLDSVSQLQGVNDQTFQVEAKRIQKKADSLSSLVTRHTDEFKLVRSNLG
NWGKETQQLLQDGKKERQKSDQLLSRASLAKSRAQEALSMGNATFYEVENILKNLREFDL
QVEDRKAEAEEAMKRLSYISQKVADASDKMEQAEGSLGSAAADAQRAKNAAREALEISGK
IEQEIGSLNLEANVTADGALAMEKGLATLKSEMREVEGELARKELEFDTDMDTMQMVITE
ARRVDTRAKNAGVTIQDTLKSLDSILHLTDQPGSVDEERLALLEQELFQTKTRINSQLRP
LMSELEERARRQRGHLHFLEMSIDGILADVKNLENIRDNLPPGCYNTQTLEQQ
Download sequence
Identical sequences G5B450
HGL_H00000264144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]