SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264382-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264382-2
Domain Number 1 Region: 324-500,535-701
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.34e-83
Family YicI catalytic domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 1199-1389,1434-1595
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.19e-71
Family YicI catalytic domain-like 0.00024
Further Details:      
 
Domain Number 3 Region: 79-322
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.53e-49
Family YicI N-terminal domain-like 0.0086
Further Details:      
 
Domain Number 4 Region: 946-1193
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-44
Family YicI N-terminal domain-like 0.0074
Further Details:      
 
Domain Number 5 Region: 1598-1678
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.8e-16
Family Putative glucosidase YicI, domain 3 0.015
Further Details:      
 
Domain Number 6 Region: 704-784
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000424
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 
Domain Number 7 Region: 918-970
Classification Level Classification E-value
Superfamily Trefoil 0.00000000523
Family Trefoil 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264382-2
Sequence length 1818
Comment SI (Homo_sapiens) sucrase-isomaltase (alpha-glucosidase)
Sequence
MAKKKFSGLEIFLIVLFIIVTIIAIALVVILATKTPAVDEVRPPTSTPSGSGKCPADIND
PVNERINCIPDQFPTQAMCAQRGCCWKPWNNSVVPWCFFVDNHGYNVAERKTTNTGLEVS
LNRVPSPTLFGNDINSILLTTENQTPNRFRFKITDPNNRRYEVPHQFVQEHTGPAASETL
YDVQVTENPFSIKVIRKSNSKTLFDTSIGPLVYSDQYLQISTRLPSEYMYGIGEHVHKRF
RHDLYWKTWPIFTRDELPGDNNHNLYGHQTFFMGIEDTSGKSFGVFLMNSNAMEIFIQPT
PIVTYRVTGGILDFYIFLGDSPGQVVQQYQELIGLPAMPAYWSLGFQLSRWNYKSLDIVR
EVVRRNREAGIPYDTQVTDIDYMEDKKDFTYDKVAFNGLPDFVKDLHDHGQKYVIILDPA
IAISKRVNGAAYEAYDRGNAQHVWINEPDGTTPLIGEVWPGLTVFPDFTNPSCIDWWANE
CSIFHQEVNYDGIWIDMNEVSSFIQGSRNGCNDSKLNYPPFLPDILDKLMYSKTICMDAV
QSWGKHYDVHSLYGYSMAIATEKAVQKVFPNKRSFILTRSNFAGTGRHASHWLGDNTASW
EQMEWSITGMLEFGLFGMPLVGADICGFVAETTEELCRRWMQLGAFYPFSRNHNADGYEH
QDPAFFGQDSLLVKSSRHYLTIRYTLLPFLYTLFYKAHTSGETVARPFLFEFYEDTNSWI
EDTQFLWGPALLITPVLRWGAESVSAYIPDATWYDYETGVKRPWRKQRVDMYLPADKIGL
HLRGGYIIPIQQPSVTTTASRKNPLGLIIALDEGNTAKGDLFWDDGETTNTIQNGNYILY
TFSVSNNNLNIICTHSSYQEGTTLAFETIKILGLTDTVTEVTIAEINQQMNAHNNFTYDS
SNQILLIMDVHFNLGRSFTVRWNEVFSENEKFNCFPDADIVTQEKCTQRGCLWETVPSNS
EAPECYIPRQSDPYLVMSTQYLPTGITADLQLNMANARITLPSEPISTLRVEVKYHKNDM
LQFKIYDPQNKRYEVPVPLNIPTTPISTYENRLYDVEIKEKPFGIQIRRRSSGRVIWDSH
LPGFTFNNQFIQISTRLPSEYIYGFGEVEHTAFRRDMNWHTWGMFTRDQPPGYKLNSYGF
HPYYMALEEEGNAHGVLLLNSNAMDVTFQPTPALTYHTIGGILDFYMFLGPTPEVATIQY
HEVIGHPVMPPYWSLGFQLSRYGYRNTSEIEQLYSEMVSAGIPYDVQYTDIDYMERQLDF
TIGERFLELPKFVDKIREEGMKYIIILDPAISGNETQPYPAFTRGQEKDVFVKWPNTSDI
CWAKVWPDLPNVTIDETLTEDEAVDASRAHVAFPDFFKNSTAEWWGREILDFYNEKMKFD
GLWIDMNEPSSFVNGTTTNQCRNKELNYPPYFPELTKRTEGLHFRTMCMETEQILSDGSS
VLHYDVHNLYGWSQAKPTYDAVQKTTGKRGIVISRSTYPTAGRWSGHWLGDNYANWENLD
KSIIGMMEFSLFGISYTGADICGFFNNSEYHLCARWTQLGAFYPFARNHNIAFTRRQDPA
SWNQTFAEMTKKIMEIRYTLLPYFYTQMHEIHAHGGTVIRPLLHEFFNDKTTWDIFKQFL
WGPAFMVTPVLEPYVETVRGYVPNARWFDYHTRQDIGVREQFHDFHAPYDTINLHIRGGY
ILPCQEPNRTTFYSRTNFMKLIVAADDNEMAQGSLFWDDGDTINTYERDIYLLVQFNLNK
TTLRSTVLKSGYKNKTETRLGYVDVWGIGATNIKVVNLIYNENKVTTNFIHIAAQKILEI
DLRDNDVTLDEPIEISWS
Download sequence
Identical sequences G5ATG2
HGL_H00000264382-2 XP_004834601.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]