SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264661 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264661
Domain Number 1 Region: 198-436
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.01e-37
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Domain Number 2 Region: 440-627
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-31
Family cAMP-binding domain 0.00057
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.58e-25
Family Flavin-binding PAS domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264661
Sequence length 852
Comment KCNH4 (Homo_sapiens) potassium voltage-gated channel, subfamily H (eag-related), member 4
Sequence
TDSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSQLALQRLH
KALEGHQEHRAEICFYHKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDITQSGGAGLGPP
GIHGDSNHENSLGRRGASSKLRSSQRQSHSILRRLTGHFSHRGQGSMETNNNASEPKPSV
PEYKVASVGGSRCLLLHYSIPKAVWDGLILLATFYVAVTIPFNVCFLGDDAPATPRHVLI
SDVAVEMLFIVDIILNFRTTYVSQSGQVVSAPRSIGLHYLATWFFVDLIAALPFDLLYIF
NVTVTSLVHLLKTVRLLRLLRLLQKLEPYSQCSAMVLTLLMSVFVLLAHWMACIWYVIGR
REMEANDPLLWDIAGPSRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKVFSVCTMLVGA
LMHAVVFGNVTAVIQRLYSRRSLYHRRLKDLEDFVRVHRLPRPLEQRVLEYFQTTWAANS
GIDANELLRDFPDELRADVAMHLNREILQLPLFGVASRGCLRALSLHIKASFCAPGEYLL
RRGDALQAHYYVCSGSLEVLQDSTVLAILGKGDLIGADIPEPGVGPSFVLKTSADVKALT
YCGLQQLSSQGLAEVLQLYPEYGAAFRAGLPRDLTFNLRQGIDTSALSRCSRSPRLSQPR
SDSLGSSSDKTLPSISETEGSSGVPGGAAPPLPALSPARPQGSLLSLLGEELPPLSALLP
EAPQRLIPPLGPCGPLDLSPRVVDGIEDSGSTAEAPMFRFSKAPLPGPPCRPGPELATEA
ESVREKVCGLNQEISRLNQEVSQLSRELRLMMGLLQAHMGPLGSPAPTAWPPDLPRPKWR
PLCSSPCASGPP
Download sequence
Identical sequences G5B0K4
HGL_H00000264661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]