SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264839 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264839
Domain Number 1 Region: 498-628
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.68e-30
Family Synaptotagmin-like (S variant) 0.00000229
Further Details:      
 
Domain Number 2 Region: 1198-1317
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.21e-23
Family Synaptotagmin-like (S variant) 0.0088
Further Details:      
 
Domain Number 3 Region: 54-130
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.07e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0063
Further Details:      
 
Domain Number 4 Region: 333-460
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-19
Family PDZ domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264839
Sequence length 1346
Comment RIMS1 (Homo_sapiens) regulating synaptic membrane exocytosis 1
Sequence
MGMLKDTELEQAAAAAENSRTKGKFRGRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPT
CGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNVMWVCNLCRKQQEILTKSGAWF
FGSGPQQPSQDGTLSDTATGAGSEAPREKRARLQERSRSQTPLSTAAATSQDAAPPSAAQ
DRSTGVEPSPKALGPEQKQASSRCRSEPPRERKKAPGPSEPSGRGAQRAQGRLEPGAAVL
VRKAKREKVETMLRNDSLSSDQSESVRPSPPKPHRAKRSGKKRQMSVSSSEEEGVSTPEY
TSCDDAELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRVILN
KRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKP
LPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPS
ISVISPTSPGALKDAPQVLPGQLAVKLWYDKVGHQLIVNVLQATDLPCRVDGRPRNPYVK
MYFLPDRSDKSKRRTKTVKKVLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQEEES
EFLGEILIELETALLDDEPHWYKLQTHDESSLPLPHPSPFMPRRHIHGESSSKKLQRSQR
ISDSDISDYEVDDGIGVVPPEISYRFAPYVSSIQYREQIDLDGDADSTYVKSLSEGPVGY
RSNARESKSTTLTVPEQQRTTHHRSRSVSPHRGDDQGRPRSRLPNVPLQRSLDEIHPTRR
SRSPTRHHDASRSPPEHRPRDVDSQYLAEQDSELLMLPRAKRGRSAECLHTTSELQPSLD
RARSASTNCLRPDTSLHSPERERGRWSPSLDRRRPPSPRIQIQHASPENDRHSRKSERSS
IQKQTRKGTTSDAERTHRQGSPTQSPPADTAFSSRRGRQLPQVPVRSGSIEQASLVVEER
TRQMKMKVHRFKQTTGSGSSQELDREQYSKYNIHKDQYRSCDNVSAKSSDSDVSDVSAIS
RTSSASRLSSTSFLSEQSELPRGRISQSDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRS
TSQLSQTELTAVQEKAGWLTLGGDLLSLSESGHKKLKSTIQRSTETGMAAEMRKMVRQPS
RESTDGSVNSYSSEGNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGM
EDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQ
SLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVD
PTVTPLTRRASQSSLESSTGPPCIRS
Download sequence
Identical sequences G5ALU1
HGL_H00000264839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]