SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000264867 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000264867
Domain Number 1 Region: 670-737
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000285
Family Canonical RBD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000264867
Sequence length 797
Comment PPARGC1A (Homo_sapiens) peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Sequence
MAAAWGITSARLKYYEQQCAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AVVKTENSWSNKTKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHVQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRHSESSGTQVNNSTKKGPEQSELYAQLSK
SSVLGSGQEERKTKRPSLRLFGDHDYCQSINSKTEIIINISQELQDSRQLDYKDASSDWQ
GQVCSSTDSDQCYLRETLEASKQLSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TSELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFDVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSRSCY
YYESSHYRHHTHRNSPLYVRSRSRSPYSRRPRYDSYEAYQHERLKREEYRKEYDKRESER
AKQRERQRQKAIEERRVIYIDKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFIT
YRYTCDAFAALENGYTLRRSNEMDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYD
SLDFDSLLKEAQRSLRR
Download sequence
Identical sequences G5C133
HGL_H00000264867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]