SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265036 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265036
Domain Number 1 Region: 100-204
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-23
Family DEP domain 0.013
Further Details:      
 
Domain Number 2 Region: 327-419
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000177
Family BCR-homology GTPase activation domain (BH-domain) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265036
Sequence length 658
Comment DEPDC1B (Homo_sapiens) DEP domain containing 1B
Sequence
MEHRLVGPGPYRATKLQKQNEQQELQSWGQQRWMQHHSRQLASLAIPWAVVFFKGFLIQL
TDDLVESVVFFLDAHTGQYLLAVLGIGGRLSLKGASKREMTACWNETVELFRARMPLRKH
RCRLKSYECCFTAAEAVDWLHELLRCSQNFGPEVTRKQTVQLLKKFLKNHVIEDIKGKWG
QEDFEDNRHLYRFPPSSPLKPYPKKPPYQKDVIKFPGWNDSPADTSQENIPVRPVVMNSE
MWFKRHSIAIGEVPACRLVHRRQLTEAHVEEIWKSMTLSYLQKILGLDSLEEVLDIKLVN
SKFIIHNVYSVSKQGVVILDDKSSLLQKEKMAVEAFQICCLLLPPENRRKLQLLMRMMAR
ICLNKEMPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVP
LALQTSIEERVAHLRRVQDLHPEGPKASGGSQKTCAGGLKDLCRKAEGCILEPGSDAHGE
DQSSPDENSSHSQPQRGPKFLPQGETAKFTSGKPSSASFSQKIKRPRSSPPVLFFMAIGN
NPQIKYPGADMDITLSAPSFCRQISPEEFEYQRTYGSQEPLAALLEEVITDTKLSSKEKK
KKLKQFQKSYPEVYQERFPTPESEALLFSEKPKPKTQLFMWALKNPFQPFQRTRSFRM
Download sequence
Identical sequences G5BHG5
HGL_H00000265036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]