SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265174 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265174
Domain Number 1 Region: 399-622
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.09e-75
Family ATP sulfurylase catalytic domain 0.00000000258
Further Details:      
 
Domain Number 2 Region: 237-393
Classification Level Classification E-value
Superfamily PUA domain-like 9.25e-51
Family ATP sulfurylase N-terminal domain 0.0000000358
Further Details:      
 
Domain Number 3 Region: 34-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.3e-39
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.000000219
Further Details:      
 
Domain Number 4 Region: 2-40
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000115
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265174
Sequence length 628
Comment PAPSS1 (Homo_sapiens) 3'-phosphoadenosine 5'-phosphosulfate synthase 1
Sequence
MELPRSLCKKAKLGHGAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
SGAGKTTVSMALEEHLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
ADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
EIKGKWRWFTGIDAEYEKPEAPELVLKTDACDVNDCVQQVVELLQERDIVPVDASYEVKE
LYVPENKLHLAKTDAESLPALQITKVDMQWVQVLAEGWATPLGGFMREREYLQCLHFDCL
LDGGVMNLSVPIVLTATQEDKERLDGCTAFALLYEGRRVAILRNPEFFEHRREERCARQW
GTMCKSHPYIKMVMEQGDWLIGGDLQVLDRIYWNDGLDQYRLTPTELRQKFKDMNADAVF
AFQLRNPVHNGHALLMQDTHRQLLERGYRRPVLLLHPLGGWTKEDDVPLAWRMKQHAAVL
EEGVLPPESTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDL
YEPTHGAKVLTMAPGLISLEIVPFRVAAYNRRKKQMDYYDAEHHEDFEFISGTRMRRLAR
DGQKPPEGFMAPAAWAVLVEYYKALEKA
Download sequence
Identical sequences G5AQK6
HGL_H00000265174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]